Recombinant Arabidopsis thaliana UDP-glucuronate 4-epimerase 1 (GAE1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
GAE1; UGlcAE3; At4g30440; F17I23.220; UDP-glucuronate 4-epimerase 1; UDP-glucuronic acid epimerase 1; AtUGlcAE3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-429
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
GAE1
Target Protein Sequence
MPSIEDELFPSTPGKFKIDRSNRQLHRCFASTSTMFLWALFLIALTASYLSFQSFVDSGS RYLTASWGGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVGLDNF NNYYDPSLKRARRSLLSSRGIFVVEGDLNDAKLLAKLFDVVAFTHVMHLAAQAGVRYALE NPQSYVHSNIAGLVNLLEICKAANPQPAIVWASSSSVYGLNEKVPFSESDRTDQPASLYA ATKKAGEEITHTYNHIYGLAITGLRFFTVYGPWGRPDMAYFSFTRNILQGKPITIYRGKN RVDLARDFTYIDDIVKGCLGSLDSSGKSTGSGGKKRGAAPYRIFNLGNTSPVTVPILVDI LEKHLKVKAKRNFVEMPGNGDVPFTHANISSARNEFGYKPTTDLETGLKKFVRWYLSYYG YNTKAKLVH
Uniprot No.

Target Background

Function
This protein is involved in the biosynthesis of the negatively charged monosaccharide that constitutes the backbone of pectic cell wall polysaccharides.
Database Links

KEGG: ath:AT4G30440

STRING: 3702.AT4G30440.1

UniGene: At.20969

Protein Families
NAD(P)-dependent epimerase/dehydratase family
Subcellular Location
Golgi apparatus, Golgi stack membrane; Multi-pass membrane protein.
Tissue Specificity
In root stele, leaves, siliques, flowers, pollen and stems.

Q&A

What is the function of UDP-glucuronate 4-epimerase 1 (GAE1) in Arabidopsis thaliana?

GAE1 (also known as UGlcAE3) catalyzes the epimerization of UDP-alpha-D-glucuronic acid (UDP-GlcA) to UDP-alpha-D-galacturonic acid (UDP-GalA). This reaction is critical for the biosynthesis of cell wall polysaccharides, particularly pectins, which are major components of plant cell walls. UDP-GalA produced by this enzymatic conversion serves as a precursor for numerous cell-surface polysaccharides in plants . The gene belongs to a family with six isoforms in Arabidopsis, all encoding putative type-II membrane proteins consisting of a variable N-terminal region and a conserved C-terminal catalytic domain .

How is GAE1 structurally organized in Arabidopsis thaliana?

GAE1 in Arabidopsis thaliana has a bipartite structure consisting of:

  • An N-terminal region (approximately 120 amino acids) comprising:

    • A predicted cytosolic domain

    • A transmembrane domain

    • A stem domain

  • A C-terminal catalytic region (approximately 300 amino acids) containing:

    • A highly conserved catalytic domain found in the epimerase/dehydratase protein family

The full amino acid sequence consists of 429 amino acids, and the recombinant enzyme has a predicted molecular mass of approximately 43 kD, although size-exclusion chromatography suggests it may exist as a dimer (approximately 88 kD) .

What is the difference between the various UDP-glucuronate 4-epimerase isoforms in Arabidopsis?

Arabidopsis contains six UDP-glucuronate 4-epimerase isoforms (GAE1-6), which share sequence similarity but have distinct expression patterns and potentially specialized functions:

IsoformGene NameAlternative NamesLocus IDDistinctive Features
GAE1UGlcAE3UDP-D-glucuronate 4-epimerase 1At4g30440Cooperates with GAE6 in cell wall development
GAE2-UDP-D-glucuronate 4-epimerase 2-Less well characterized than other isoforms
GAE3-UDP-D-glucuronate 4-epimerase 3-Different catalytic properties compared to GAE1
GAE4UGlcAE1UDP-D-glucuronate 4-epimerase 4-One of the first characterized epimerases in plants
GAE5-UDP-D-glucuronate 4-epimerase 5-Differential expression compared to other isoforms
GAE6UGlcAE2UDP-D-glucuronate 4-epimerase 6-Functions in coordination with GAE1

While all catalyze the same core reaction, differences in expression patterns, substrate affinities, and regulatory properties suggest non-redundant physiological roles .

What biochemical conditions optimize the activity of recombinant GAE1?

Recombinant GAE1 exhibits the following optimal biochemical parameters:

ParameterOptimal ConditionNotes
pH7.5Maximum enzymatic activity
Temperature20-55°CActive range; activity decreases above 55°C
Equilibrium constant~1.9Favors formation of UDP-GalA over UDP-GlcA
Cofactor requirementNAD⁺Tightly bound; exogenous addition not required
InhibitorsUDP-Xyl, UDP-AraPotential regulatory role in pectin synthesis
Non-inhibitorsUDP-Glc, UDP-Gal, UMPDo not affect enzymatic activity

When designing experiments with recombinant GAE1, buffer systems maintaining pH 7.5 and temperature control below 55°C will ensure optimal enzyme performance. The enzyme should be stored at -20°C with 50% glycerol in a Tris-based buffer, with working aliquots kept at 4°C for up to one week to avoid repeated freeze-thaw cycles .

How can I functionally characterize GAE1 activity in experimental settings?

For functional characterization of GAE1 activity, several approaches are effective:

  • HPLC-based biochemical assay: Establish a reaction mixture containing purified recombinant GAE1, UDP-GlcA substrate, and appropriate buffer (pH 7.5). Incubate at room temperature or 30°C, then analyze reaction products via HPLC to quantify UDP-GalA formation .

  • NMR spectroscopy verification: Confirm product identity using ¹H-NMR spectroscopy. Key diagnostic features for UDP-GalA include:

    • Coupling constant ³J₁″,₂″ of 3.7 Hz between protons H-1″ and H-2″

    • Large 10.2-Hz coupling constant between trans-configuration protons 2″ and 3″

    • Short 3.2-Hz signal for coupling constants between cis-configuration protons 3″ and 4″

  • Steady-state kinetic analysis: Determine kinetic parameters (Km, Vmax) by varying substrate concentrations. For GAE family enzymes, the apparent Km for UDP-GlcA is approximately 720 μM .

  • Equilibrium studies: To determine the equilibrium constant, incubate the enzyme with UDP-GlcA for various times and measure the UDP-GalA/UDP-GlcA ratio using chromatographic methods .

What methods can be used to express and purify recombinant GAE1 for research purposes?

Several expression systems and purification strategies have been validated for recombinant GAE1:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, simple cultivationMay require codon optimization, potential inclusion body formation
YeastEukaryotic post-translational modificationsLonger cultivation time than E. coli
BaculovirusComplex eukaryotic modificationsMore complex system, higher cost
Mammalian cellMost similar to plant modificationsHighest complexity and cost
Cell-free expressionRapid production, avoids cellular constraintsLower yield, higher cost of components

Purification protocol outline:

  • Express full-length or truncated GAE1 (consider removing N-terminal transmembrane domain for improved solubility)

  • Lyse cells in Tris-based buffer at pH 7.5-8.0

  • Purify using affinity chromatography with appropriate tag (His, GST, etc.)

  • Further purify by size-exclusion chromatography (look for ~88 kD peak for dimeric form)

  • Verify purity via SDS-PAGE (target ≥85% purity)

  • Store in buffer containing 50% glycerol at -20°C for short-term or -80°C for long-term storage

What is the catalytic mechanism of GAE1 and how does it differ from UDP-GlcA decarboxylases?

The catalytic mechanism of GAE1 involves a transient UDP-4-keto-hexose-uronic acid intermediate. The reaction proceeds through the following steps:

  • Substrate binding: UDP-GlcA binds in the active site, positioned by enzyme residues including a conserved tyrosine.

  • Oxidation at C4: NAD⁺ (tightly bound to the enzyme) abstracts a hydride from the substrate's C4, forming a 4-keto intermediate.

  • Rotation: The 4-keto intermediate rotates within the active site.

  • Reduction: The same NAD⁺ returns the hydride to the opposite face of C4, completing the epimerization.

  • Product release: UDP-GalA is released from the active site.

GAE1 and UDP-GlcA decarboxylases share initial mechanistic steps (both form a 4-keto intermediate), but differ critically in subsequent steps:

  • Epimerase pathway: Carefully controls substrate positioning to enable stereo-electronic rotation and prevent decarboxylation

  • Decarboxylase pathway: Promotes β-elimination of the carboxyl group from the keto intermediate

The epimerase includes precise conformational control that prevents decarboxylation of the labile β-keto acid species, likely through specific active site architecture that imposes stereo-electronic constraints . Kinetic isotope effect studies with C4-deuterated substrates have shown a KIE of approximately 2.0, indicating that hydride abstraction from UDP-GlcA contributes to the rate-limiting step .

How do GAE1 and GAE6 cooperate in cell wall development, and what phenotypes are observed in gae1/gae6 mutants?

GAE1 and GAE6 demonstrate functional cooperation in Arabidopsis cell wall development, particularly in pectin biosynthesis. The double mutant gae1-1 gae6-1 exhibits more severe phenotypes than either single mutant:

Phenotypic characteristics of gae1-1 gae6-1 double mutant:

  • Slightly smaller than wild-type plants

  • Brittle leaves (break easily)

  • Low galacturonic acid (GalA) levels in cell walls

  • Reduced pectin content

  • Increased susceptibility to Botrytis cinerea infection

These observations suggest that while there is some functional redundancy among GAE family members, GAE1 and GAE6 have specialized roles that cannot be fully compensated by other family members. The cooperation between these isoforms appears critical for maintaining cell wall integrity and normal plant development.

Research indicates the phenotypes result from reduced capacity to synthesize UDP-GalA, which limits pectin production. The increased pathogen susceptibility further suggests that proper pectin composition contributes to plant defense mechanisms .

How does GAE1 regulation integrate with broader cell wall biosynthesis pathways and developmental processes?

GAE1 functions within an intricate network of enzymes and regulatory factors controlling cell wall biosynthesis. Key aspects of this integration include:

  • Feedback regulation: GAE1 activity is inhibited by UDP-Xyl and UDP-Ara, suggesting a regulatory mechanism by which different cell wall polymers can influence pectin synthesis rates .

  • Developmental coordination: Expression patterns of GAE1 and other family members vary across tissues and developmental stages, indicating specialized roles in different plant organs and growth phases .

  • Stress responses: Cell wall remodeling occurs during various stress responses, and GAE activity likely coordinates with stress signaling pathways to modify wall properties.

  • Hormone interactions: Cell wall biosynthesis is influenced by multiple plant hormones. While not directly addressed in the provided data, other research suggests coordination between cell wall-modifying enzymes and hormone signaling networks. For example, gibberellic acid (GA) signaling has been shown to regulate other aspects of cell wall development, with DELLA proteins like RGA controlling downstream targets in anther and pollen development .

A systems biology approach is necessary to fully understand how GAE1 regulation is coordinated with broader developmental programs and environmental responses.

What are the most promising approaches for investigating GAE1 function in plant cell wall synthesis using advanced research techniques?

Several cutting-edge approaches show promise for deeper investigation of GAE1 function:

  • CRISPR/Cas9 genome editing:

    • Generate precise mutations in GAE1 catalytic residues to study structure-function relationships

    • Create conditional knockouts using inducible CRISPR systems to study temporal aspects of GAE1 function

    • Multiplex editing to target multiple GAE family members simultaneously for comprehensive functional analysis

  • Cryo-EM structural analysis:

    • Determine high-resolution structures of GAE1 in different conformational states

    • Visualize enzyme-substrate complexes to understand binding specificity

    • Compare structures across GAE family members to identify isoform-specific features

  • Metabolic flux analysis:

    • Use isotope labeling to track carbon flow through the UDP-GlcA/UDP-GalA pathway

    • Quantify changes in flux upon manipulation of GAE1 expression

    • Integrate with computational models of cell wall biosynthesis

  • Synthetic biology approaches:

    • Engineer modified GAE1 variants with altered catalytic properties or regulatory features

    • Create synthetic regulatory circuits to control GAE1 expression in response to specific signals

    • Develop orthogonal pathways for pectin synthesis to probe GAE1 essentiality

  • Single-cell transcriptomics and proteomics:

    • Profile GAE1 expression at single-cell resolution during development

    • Identify cell-specific cofactors and regulatory partners

    • Map spatial patterns of enzyme activity in tissues with complex architecture

These approaches, particularly when combined, offer powerful ways to dissect GAE1 function beyond what has been possible with conventional genetic and biochemical methods .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.