Recombinant Arabidopsis thaliana UDP-glucuronate 4-epimerase 2 (GAE2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Advance notice is required for dry ice shipments, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
GAE2; At1g02000; F22M8.13; UDP-glucuronate 4-epimerase 2; UDP-glucuronic acid epimerase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-434
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
GAE2
Target Protein Sequence
MSHLDDIPSTPGKFKMMDKSPFFLHRTRWQSSVAKLAFWSLVFFGLLFIFFYRSPISNPD SSRRSLRTYSWGGPAWEKRVRSSARVRTRNGVSVLVTGAAGFVGTHVSAALKRRGDGVLG LDNFNDYYDTSLKRSRQALLERSGVFIVEGDINDLSLLKKLFEVVPFTHVMHLAAQAGVR YAMENPGSYVHSNIAGFVNLLEVCKSANPQPAIVWASSSSVYGLNTKVPFSEKDRTDQPA SLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFTRDILKGKAISIF EGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLRVFNLGNTSPVPVTD LVSILERLLKVKAKRNMMKLPRNGDVPFTHANISSAQREFGYKPSTDLQTGLKKFVRWYL GYYKQGGKKVAAAA
Uniprot No.

Target Background

Function
Involved in the synthesis of the negatively charged monosaccharide forming the backbone of pectic cell wall components.
Database Links

KEGG: ath:AT1G02000

STRING: 3702.AT1G02000.1

UniGene: At.17005

Protein Families
NAD(P)-dependent epimerase/dehydratase family
Subcellular Location
Golgi apparatus, Golgi stack membrane; Multi-pass membrane protein.
Tissue Specificity
In roots, leaves, siliques, flowers, pollen and stems.

Q&A

What is the role of UDP-glucuronate 4-epimerase in plant cell wall synthesis?

UDP-glucuronate 4-epimerase (UGlcAE/GAE) catalyzes the epimerization of UDP-alpha-D-glucuronic acid (UDP-GlcA) to UDP-alpha-D-galacturonic acid (UDP-GalA). This reaction is critical for plant cell wall development because UDP-GalA serves as a precursor for the synthesis of numerous cell-surface polysaccharides, particularly pectins, which are major components of the primary cell wall in plants . The formation of UDP-GalA represents a rate-limiting step in pectin biosynthesis, making GAE enzymes important control points in cell wall metabolism.

The significance of this enzymatic conversion extends beyond basic structural roles, as alterations in pectin content and composition affect various physiological processes including cell expansion, fruit development, and abscission. Research has demonstrated that changes in the expression of genes involved in this pathway can lead to modified cell wall properties and consequent phenotypic effects .

How does GAE2 relate to other members of the UGlcAE gene family?

In Arabidopsis thaliana, the UDP-glucuronate 4-epimerase family consists of six isoforms that share structural similarities but may have distinct expression patterns and functional specificities. All members of this gene family encode putative type-II membrane proteins with two primary domains :

  • A variable N-terminal region (approximately 120 amino acids long) composed of:

    • A predicted cytosolic domain

    • A transmembrane domain

    • A stem domain

  • A conserved C-terminal catalytic region (approximately 300 amino acids long) containing:

    • A highly conserved catalytic domain found in a large family of epimerase/dehydratases

While the basic catalytic mechanism is likely conserved across all isoforms, differences in expression patterns, subcellular localization, and regulatory mechanisms may contribute to their specialized functions in different tissues or developmental stages.

What are the biochemical properties of GAE enzymes in Arabidopsis?

Based on characterization of AtUGlcAE1, which serves as a model for understanding other isoforms including GAE2, these enzymes demonstrate specific biochemical properties:

  • Molecular structure: The recombinant enzyme has a predicted molecular mass of approximately 43 kD, although size-exclusion chromatography suggests it may exist as a dimer (approximately 88 kD)

  • Catalytic activity: Forms UDP-GalA with an equilibrium constant value of approximately 1.9

  • Substrate affinity: Has an apparent Km value of 720 μM for UDP-GlcA

  • Optimal conditions: Maximum activity at pH 7.5 and active between 20°C and 55°C

  • Regulation: Not inhibited by UDP-Glc, UDP-Gal, or UMP, but inhibited by UDP-Xyl and UDP-Ara, suggesting these nucleotide sugars play a role in regulating pectin biosynthesis

Table 1. Biochemical Properties of Characterized UDP-glucuronate 4-epimerase from Arabidopsis thaliana

PropertyValueNotes
Molecular Mass~43 kD (monomer)May exist as dimer (~88 kD)
Equilibrium Constant~1.9For UDP-GalA formation
Km for UDP-GlcA720 μMSubstrate affinity
Optimal pH7.5For maximum activity
Temperature Range20°C - 55°CFor enzymatic activity
InhibitorsUDP-Xyl, UDP-AraPotential regulatory mechanism
Non-inhibitorsUDP-Glc, UDP-Gal, UMPDo not affect enzyme activity

How do transcription factors regulate GAE expression and activity?

Recent research has revealed complex transcriptional regulation of genes involved in cell wall metabolism. For example, studies on the litchi transcription factor LcERF2 have demonstrated that it modulates cell wall metabolism by directly targeting UDP-glucose-4-epimerase genes . Although this specific study focused on a different epimerase (UDP-glucose-4-epimerase rather than UDP-glucuronate-4-epimerase), similar regulatory mechanisms likely govern GAE2 expression.

In Arabidopsis, transcriptome analysis indicated that expression of UDP-glucose-4-epimerase homologs (AtUGE2-4) was significantly reduced in response to LcERF2 overexpression . This suggests that transcription factors from the ERF family may play conserved roles in regulating epimerase gene expression across plant species. By extension, GAE2 expression might be regulated by similar transcription factor families that coordinate cell wall metabolism in response to developmental cues or environmental signals.

What functional genomics approaches can reveal GAE2-specific functions?

To elucidate GAE2-specific functions among the six isoforms, several functional genomics approaches can be employed:

  • Gene expression profiling: Analyzing tissue-specific and developmental expression patterns of all six GAE isoforms can reveal when and where GAE2 is predominantly expressed, providing clues to its specific functions.

  • Loss-of-function studies: Knock-out or knock-down lines specific to GAE2 can reveal phenotypes associated with its deficiency. For example, silencing studies of related epimerases have shown effects on pedicel development and fruit abscission .

  • Gain-of-function studies: Overexpression of GAE2 can reveal dosage effects and potential functional redundancy with other isoforms.

  • Protein-protein interaction studies: Identifying proteins that specifically interact with GAE2 can reveal its integration in larger metabolic networks.

  • Metabolite profiling: Analyzing changes in cell wall composition, especially pectin content and structure, in GAE2 mutants can provide direct evidence of its biochemical function in vivo.

How does GAE2 activity influence pectin biosynthesis and cell wall properties?

The conversion of UDP-GlcA to UDP-GalA catalyzed by GAE enzymes represents a crucial step in providing precursors for pectin biosynthesis. Studies of related epimerases have shown that altered expression levels correlate with changes in cell wall composition and physical properties. For instance:

  • Reduced expression of LcERF2 in litchi was associated with increased levels of hexoses (particularly galactose) and pectin abundance in the cell wall

  • Ectopic expression of LcERF2 in Arabidopsis caused reduced pedicel galactose and pectin contents

  • Silencing of UDP-glucose-4-epimerase in litchi resulted in significantly reduced pedicel diameter and enhanced fruit abscission

By analogy, alterations in GAE2 expression or activity would likely affect:

  • UDP-GalA availability for pectin synthesis

  • Pectin content and composition in the cell wall

  • Mechanical properties of the cell wall

  • Developmental processes dependent on proper cell wall formation

What is the relationship between hormone signaling and GAE2 regulation?

Plant hormones play critical roles in regulating cell wall metabolism. Studies of promoter elements in genes associated with cell wall modification provide insight into potential regulatory mechanisms. For instance, PP2C-like promoter in Arabidopsis contains multiple ACGT elements that respond to hormones including abscisic acid (ABA) .

While specific information about GAE2 promoter elements is not provided in the search results, it's reasonable to hypothesize that hormonal regulation may influence GAE2 expression. PLACE and PlantCARE database analyses of related promoters have identified elements responsive to:

  • Abscisic acid (ABA)

  • Salicylic acid (SA)

  • Jasmonic acid (JA)

  • Light signaling

Future research should investigate:

  • The presence of hormone-responsive elements in the GAE2 promoter

  • Expression changes of GAE2 in response to different hormonal treatments

  • The integration of hormone signaling with cell wall metabolism during development and stress responses

What are the optimal conditions for expressing and purifying recombinant GAE2?

Based on experiences with similar recombinant epimerases:

  • Expression system selection: While bacterial expression systems like E. coli provide high protein yields, eukaryotic systems such as yeast may be more suitable for obtaining properly folded and post-translationally modified plant enzymes.

  • Protein purification strategy: Given that GAE2 is likely a membrane-associated protein with a transmembrane domain, solubilization strategies using appropriate detergents are crucial for maintaining enzymatic activity during purification.

  • Activity preservation: The enzyme exhibits maximum activity at pH 7.5 and remains active between 20°C and 55°C , suggesting that purification and storage conditions should maintain these parameters.

  • Oligomeric state consideration: Since related epimerases may exist as dimers , purification strategies should preserve the native oligomeric state of the enzyme.

A suggested purification protocol would include:

  • Expression with an appropriate affinity tag

  • Membrane fraction isolation

  • Detergent solubilization

  • Affinity chromatography

  • Size exclusion chromatography

  • Activity verification using a UDP-GlcA substrate

How can GAE2 enzymatic activity be assayed in vitro?

Several complementary approaches can be used to assay GAE2 activity:

  • Spectrophotometric assays: Coupling the epimerization reaction with NAD+/NADH-dependent dehydrogenases allows indirect measurement of activity through changes in absorbance at 340 nm.

  • HPLC-based methods: Separation and quantification of UDP-GlcA substrate and UDP-GalA product using anion exchange or reverse-phase HPLC with UV detection.

  • Mass spectrometry: Detection and quantification of reaction products using LC-MS/MS, allowing for high sensitivity and specificity.

  • NMR spectroscopy: For detailed mechanistic studies, NMR can track the conversion between UDP-GlcA and UDP-GalA in real-time and provide structural insights.

Key parameters to determine include:

  • Km and Vmax for UDP-GlcA

  • Equilibrium constant for the reaction

  • pH and temperature optima

  • Effects of potential inhibitors (UDP-Xyl, UDP-Ara) and non-inhibitors (UDP-Glc, UDP-Gal, UMP)

What genetic approaches are most effective for studying GAE2 function in planta?

Several genetic approaches can be employed to study GAE2 function in vivo:

How can researchers differentiate between the functions of different GAE isoforms?

Distinguishing the specific functions of GAE2 from other isoforms requires:

  • Detailed expression profiling: Comparing expression patterns of all six isoforms across tissues, developmental stages, and in response to environmental stimuli using RNA-seq or qRT-PCR.

  • Isoform-specific antibodies: Developing antibodies that specifically recognize GAE2 for immunolocalization and protein quantification studies.

  • Chimeric protein analysis: Creating chimeric proteins between different GAE isoforms to identify domains responsible for specific functions or localization patterns.

  • Complementation experiments: Testing whether GAE2 can complement phenotypes of other GAE isoform mutants, and vice versa, to assess functional overlap.

  • Substrate specificity testing: Comparing kinetic parameters of all isoforms with various substrates to identify potential specialization.

How does GAE2 integrate into broader cell wall synthesis networks?

Understanding how GAE2 functions within the larger context of cell wall synthesis requires:

  • Interactome analysis: Identifying protein-protein interactions between GAE2 and other enzymes involved in cell wall synthesis.

  • Metabolic flux analysis: Tracing carbon flow through the UDP-GlcA to UDP-GalA conversion and subsequent incorporation into cell wall components.

  • Co-expression network analysis: Identifying genes whose expression patterns correlate with GAE2 across various conditions to reveal functional associations.

What is the evolutionary significance of having multiple GAE isoforms?

Evolutionary analyses could reveal:

  • Phylogenetic relationships: Comparing GAE sequences across plant species to understand evolutionary history and potential functional divergence.

  • Selection pressure analysis: Identifying conserved domains versus rapidly evolving regions that might confer isoform-specific functions.

  • Comparative genomics: Examining GAE gene family expansion or contraction across plant lineages in relation to cell wall complexity.

This evolutionary perspective could provide insights into why Arabidopsis maintains six GAE isoforms and how their specialized functions contribute to plant adaptation and development.

How does GAE2 function respond to environmental stresses?

Given that cell wall composition changes in response to environmental challenges, investigating GAE2's role in stress responses could involve:

  • Stress-induced expression analysis: Monitoring GAE2 expression under drought, salinity, pathogen attack, and other stresses.

  • Phenotypic characterization of mutants under stress: Testing GAE2 mutant or overexpression lines for altered stress tolerance.

  • Cell wall composition analysis: Examining how stress conditions affect pectin content and composition in wild-type versus GAE2 mutant plants.

Understanding these relationships could reveal GAE2's role in plant adaptation and potentially inform strategies for improving crop resilience.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.