Recombinant Arabidopsis thaliana UDP-glucuronate 4-epimerase 3 (GAE3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GAE3; At4g00110; F6N15.16; UDP-glucuronate 4-epimerase 3; UDP-glucuronic acid epimerase 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-430
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
GAE3
Target Protein Sequence
MKQMSHLDDIPSTPGKFKPYFHRTRWQSSVAKLAFWSLVFVGLIFIFFYRSPVSSNPADP SRRSLRTYSWGGPAWEKRVRSSARLRTRRGFSVLVTGAAGFVGTHVSAALKRRGDGVLGL DNFNDYYDPSLKRARQALLERSGVFVVEGDINDAALLKKLFEVVPFTHVMHLAAQAGVRY AMENPSSYVHSNIAGFVNLLEVCKSANPQPAIVWASSSSVYGLNTKVPFSEKDRTDQPAS LYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFTRDILKGKAISIFE GVNHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLRVFNLGNTSPVPVTDL VTILERLLKVKAKRNIMKLPRNGDVQFTHANISSAQRELGYKPTTDLQTGLKKFARWYLG YYNGGKKAAS
Uniprot No.

Target Background

Function
UDP-glucuronate 4-epimerase 3 (GAE3) is involved in the biosynthesis of the negatively charged monosaccharides that constitute the backbone of pectin, a crucial component of plant cell walls.
Database Links

KEGG: ath:AT4G00110

STRING: 3702.AT4G00110.1

UniGene: At.27610

Protein Families
NAD(P)-dependent epimerase/dehydratase family
Subcellular Location
Golgi apparatus, Golgi stack membrane; Multi-pass membrane protein.
Tissue Specificity
In roots, leaves, siliques, flowers, pollen and stems.

Q&A

What is the biochemical function of UDP-glucuronate 4-epimerase 3 (GAE3) in Arabidopsis thaliana?

UDP-glucuronate 4-epimerase 3 (GAE3) belongs to a family of enzymes that catalyze the epimerization of UDP-alpha-D-glucuronic acid (UDP-GlcA) to UDP-alpha-D-galacturonic acid (UDP-GalA). This conversion is a critical step in providing precursors for the synthesis of numerous cell-surface polysaccharides in plants, particularly pectin components of the cell wall . The reaction involves the modification of the stereochemistry at the C4 position of the sugar moiety, and occurs with an equilibrium constant of approximately 1.9 as observed with the related AtUGlcAE1 isoform . This enzymatic reaction is essential for plant development as UDP-GalA serves as the building block for homogalacturonan and rhamnogalacturonan I, which are major constituents of plant cell walls.

How is GAE3 structurally organized compared to other UGlcAE family members?

Based on characterization of the UGlcAE family in Arabidopsis, GAE3 likely shares the conserved structural organization observed in other family members. These enzymes typically consist of two major domains: a variable N-terminal region of approximately 120 amino acids comprising predicted cytosolic, transmembrane, and stem domains, followed by a highly conserved C-terminal catalytic region of approximately 300 amino acids . The catalytic domain belongs to a large protein family of epimerase/dehydratases that share similar mechanisms. While the specific molecular mass of GAE3 has not been directly reported in the available data, related family members like AtUGlcAE1 have a predicted molecular mass of approximately 43 kDa, though size-exclusion chromatography suggests they may function as dimers (approximately 88 kDa) . This dimerization may be important for the catalytic activity of these enzymes.

What are the optimal conditions for assaying recombinant GAE3 enzymatic activity?

Based on studies with the related AtUGlcAE1 enzyme, optimal conditions for GAE3 activity assays would likely include:

ParameterOptimal ConditionNotes
pH7.5Buffer systems such as HEPES or phosphate are recommended
Temperature range20-55°CActivity significantly decreases outside this range
Substrate concentration≥720 μM UDP-GlcABased on Km value for AtUGlcAE1
CofactorsNone requiredUnlike some epimerases, NAD+ is not needed as a cofactor
Inhibitors to avoidUDP-Xyl, UDP-AraThese have been shown to inhibit related enzymes

For accurate activity measurements, it is recommended to monitor the conversion of UDP-GlcA to UDP-GalA using techniques such as HPLC with UV detection, capillary electrophoresis, or coupled enzyme assays . When designing experiments, researchers should consider that AtUGlcAE1 is not inhibited by UDP-Glc, UDP-Gal, or UMP, but this specificity should be verified for GAE3 .

What expression systems are most effective for producing recombinant GAE3 for biochemical studies?

While the search results do not specifically address expression systems for GAE3, successful strategies for related UGlcAE family members can inform approaches for GAE3. Heterologous expression in prokaryotic systems such as E. coli has been effective for the biochemical characterization of AtUGlcAE1 . When designing expression constructs, consider the following:

  • The presence of the transmembrane domain may reduce solubility, so expressing only the catalytic domain might improve yield

  • Addition of affinity tags (His, GST, etc.) at the N-terminus rather than the C-terminus to avoid interfering with the catalytic domain

  • Expression at lower temperatures (16-20°C) to improve protein folding

  • Codon optimization for the expression host if yields are low

Purification typically involves affinity chromatography followed by size-exclusion chromatography, especially important if studying the native dimeric state of the enzyme . For functional studies, it's crucial to verify that the recombinant protein maintains the expected equilibrium constant (approximately 1.9) and kinetic parameters similar to those reported for AtUGlcAE1.

How do the different UGlcAE isoforms coordinate their activities in pectin biosynthesis?

This question addresses the complex interplay between the six UGlcAE isoforms in Arabidopsis. While specific information about GAE3's unique role is limited in the search results, understanding the relative contributions of different isoforms to UDP-GalA production is critical for comprehending pectin biosynthesis regulation. Research approaches should consider:

  • Comparative expression analysis of all six isoforms across different tissues and developmental stages

  • Creation of single, double, and higher-order mutants to assess functional redundancy

  • Assessment of enzyme kinetic parameters (Km, Vmax, substrate preferences) for each isoform

  • Protein-protein interaction studies to determine if these enzymes form heterodimers or interact with other pectin biosynthetic enzymes

The observation that AtUGlcAE1 is inhibited by UDP-Xyl and UDP-Ara suggests a regulatory feedback mechanism in cell wall biosynthesis . Investigating whether GAE3 shares this inhibition pattern and how it differs from other isoforms could reveal specialized functions within the UGlcAE family and their contribution to cell wall composition in different plant tissues or under various environmental conditions.

What role does GAE3 play in plant stress responses through cell wall modifications?

Plant cell walls undergo significant remodeling during biotic and abiotic stress responses. As an enzyme involved in providing precursors for pectin biosynthesis, GAE3 likely contributes to these adaptive changes. Research questions should explore:

  • Changes in GAE3 expression and activity under different stress conditions (drought, salinity, pathogen attack)

  • Phenotypic analysis of GAE3 knockout or overexpression lines under stress conditions

  • Changes in cell wall composition, particularly pectin content and structure, in these genetic backgrounds

  • Potential signaling pathways that regulate GAE3 activity during stress responses

This research direction connects to broader studies on cell wall integrity sensing and stress signaling in plants. Methodologically, researchers could employ a combination of transcriptomics, cell wall composition analysis using techniques like FTIR spectroscopy or immunolabeling, and physiological stress response assays to elucidate GAE3's role in stress adaptation through cell wall modifications.

What approaches are most effective for studying GAE3 function through genetic manipulation in Arabidopsis?

Based on methodologies used for studying related genes in Arabidopsis, researchers could consider multiple genetic approaches:

ApproachAdvantagesConsiderations
T-DNA insertion mutantsReadily available, complete loss-of-functionFunctional redundancy may mask phenotypes
CRISPR/Cas9 gene editingPrecise mutations, potential to create allelic seriesOff-target effects must be assessed
RNAi or artificial microRNATissue-specific or inducible knockdown possibleIncomplete silencing
OverexpressionCan overcome functional redundancyMay cause pleiotropic effects
Promoter-reporter fusionsReveals expression patternsDoes not directly assess function

When analyzing phenotypes, researchers should examine various aspects of plant development and cell wall properties. For insertion mutations, researchers can reference methodologies used for GH3 family genes in Arabidopsis, where homozygous lines were analyzed for altered sensitivity to plant hormones in seedling roots . When studying genes with potential functional redundancy, creating higher-order mutants (disrupting multiple family members) is often necessary to observe clear phenotypes, as demonstrated in similar studies of gene families in Arabidopsis .

How can researchers effectively analyze alterations in cell wall composition resulting from GAE3 manipulation?

Changes in GAE3 expression or activity would be expected to affect pectin content and composition. Recommended analytical approaches include:

  • Monosaccharide composition analysis using HPAEC-PAD (High-Performance Anion Exchange Chromatography with Pulsed Amperometric Detection)

  • Immunolabeling with antibodies specific for different pectin epitopes

  • FTIR (Fourier Transform Infrared) spectroscopy for rapid screening of cell wall changes

  • NMR spectroscopy for detailed structural analysis of extracted cell wall components

  • Mechanical testing of plant tissues to assess changes in cell wall properties

When interpreting results, researchers should consider that changes in one biosynthetic pathway might trigger compensatory responses in other aspects of cell wall biosynthesis. Additionally, phenotypic analyses should include both developmental parameters (growth rate, organ morphology) and responses to environmental challenges that specifically test cell wall integrity (osmotic stress, cell wall-degrading enzymes, pathogen susceptibility).

What are the key catalytic residues in GAE3 and how do they contribute to the epimerization mechanism?

Although the specific catalytic residues of GAE3 are not detailed in the search results, inferences can be made based on the conserved catalytic domain found in the epimerase/dehydratase family. The reaction likely proceeds through:

  • Oxidation of the C4 hydroxyl group to a keto intermediate, requiring a catalytic base to abstract the proton

  • Rotation of the intermediate to present the opposite face

  • Reduction of the keto group from the opposite face, requiring a catalytic acid

Key experiments to identify catalytic residues would include:

  • Site-directed mutagenesis of conserved residues in the catalytic domain

  • Structural analysis through X-ray crystallography or cryo-EM

  • Computational modeling based on related enzymes with known structures

  • Reaction mechanism studies using isotope labeling

Understanding the catalytic mechanism would provide insights into how GAE3 achieves specificity for UDP-GlcA and how it might be regulated through modifications of these key residues.

How does protein dimerization affect GAE3 catalytic activity?

Based on size-exclusion chromatography data for AtUGlcAE1, which suggests it exists as a dimer of approximately 88 kDa , GAE3 may also function as a dimer. This oligomerization could significantly impact enzyme function through:

  • Cooperative substrate binding

  • Allosteric regulation between subunits

  • Creation of a more optimal active site at the dimer interface

  • Enhanced stability under varying cellular conditions

Research approaches to investigate dimerization effects should include:

  • Creation of forced monomeric variants through mutation of interface residues

  • Analytical ultracentrifugation to determine oligomerization states under different conditions

  • Comparison of kinetic parameters between monomeric and dimeric forms

  • Cross-linking studies to identify residues at the dimer interface

This research direction would contribute to our understanding of structure-function relationships in the UGlcAE family and could reveal potential regulatory mechanisms through the modulation of oligomerization states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.