Recombinant Arabidopsis thaliana UDP-glucuronate 4-epimerase 4 (GAE4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GAE4; UGlcAE1; At2g45310; F4L23; UDP-glucuronate 4-epimerase 4; UDP-glucuronic acid epimerase 4; AtUGlcAE1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-437
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
GAE4
Target Protein Sequence
MSRLDDIPSSPGKFKMEKSSYLHRLRFQSSLTKFAFFSFFLLCLISLLFLRSPPSINPSS PSDPSRRSLRTNTYGGPAWEKRLRSSARIRTSTNNGITVLVTGAAGFVGTHVSAALKRRG DGVIGLDNFNDYYDPSLKRARRALLERSGIFIVEGDINDVELLRKLFKIVSFTHVMHLAA QAGVRYAMENPSSYVHSNIAGFVNLLEICKSVNPQPAIVWASSSSVYGLNTKVPFSEKDK TDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFTKDILKGK SISIFESANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKRGPAQLRVFNLGNTSP VPVSDLVRILERQLKVKAKKNLIKMPRNGDVPFTHANISLAQRELGYKPTTDLQTGLKKF VRWYLSYYSGDKKAAAR
Uniprot No.

Target Background

Function
This protein is involved in the biosynthesis of the negatively charged monosaccharide that constitutes the backbone of pectic cell wall polysaccharides.
Gene References Into Functions
  1. Functional cloning of the gene and subsequent biochemical characterization of the encoded enzyme. PMID: 15563616
Database Links

KEGG: ath:AT2G45310

STRING: 3702.AT2G45310.1

UniGene: At.66419

Protein Families
NAD(P)-dependent epimerase/dehydratase family
Subcellular Location
Golgi apparatus, Golgi stack membrane; Multi-pass membrane protein.
Tissue Specificity
In roots, leaves, siliques, flowers, pollen and stems.

Q&A

What is Arabidopsis thaliana UDP-glucuronate 4-epimerase 4 (GAE4) and what is its function?

GAE4 (also known as UGlcAE1, F4L23.18) is an enzyme that catalyzes the epimerization of UDP-alpha-D-glucuronic acid (UDP-GlcA) to UDP-alpha-D-galacturonic acid (UDP-GalA). This reversible reaction is crucial for plant cell wall biosynthesis, particularly pectin formation . The enzyme belongs to a family of six isoforms in Arabidopsis (GAE1-GAE6), which are predicted to be type-II membrane proteins with a variable N-terminal region (~120 amino acids) and a conserved C-terminal catalytic region (~300 amino acids) .

How does GAE4 catalyze the epimerization reaction?

GAE4 catalyzes the epimerization of UDP-GlcA to UDP-GalA through a mechanism involving:

  • Oxidation at the substrate C4 by enzyme-bound NAD+

  • Formation of a transient UDP-4-keto-hexose-uronic acid intermediate

  • Hydride transfer from and to the substrate's C4 position

This mechanism retains the enzyme-bound cofactor in its oxidized form (≥97%) at steady state with no trace of decarboxylation . The kcat for UDP-GlcA conversion shows a kinetic isotope effect of 2.0 (±0.1) derived from substrate deuteration at C4, indicating that hydride abstraction is involved in the rate-limiting step .

What are the optimal conditions for assaying recombinant GAE4 enzymatic activity?

Based on characterization studies of related UDP-GlcA 4-epimerases, the optimal conditions for assaying GAE4 activity are:

  • pH: 7.5-7.6

  • Temperature range: 20-55°C

  • Buffer system: Tris/PBS-based buffer

  • Substrate concentration: For kinetic studies, use UDP-GlcA in the range of 0-2 mM (the Km value for AtUGlcAE1 is ~720 μM)

For enzymatic assays, a typical procedure involves:

  • Incubating recombinant GAE4 with UDP-[14C]GlcA

  • Analyzing reaction products by thin-layer chromatography (TLC) after hydrolysis to monosaccharides

  • Detecting the formation of GalA and GlcA using appropriate standards

How can I confirm the subcellular localization of GAE4 in plant cells?

To determine the subcellular localization of GAE4:

  • Construct a fusion between the full-length coding sequence of GAE4 and GFP

  • Express this fusion protein in plant cells (similar to methods used for AtSdr4L )

  • Prepare microsomal fractions from the transformed plants

  • Assay both microsomal and soluble fractions for UDP-GlcA 4-epimerase activity

  • Visualize the localization using confocal microscopy

Published data indicate that UDP-GlcA 4-epimerase activity is predominantly found in solubilized microsomal fractions rather than in soluble protein fractions, suggesting membrane localization . This is consistent with bioinformatic predictions that GAE4 is a type II membrane protein with the catalytic domain in the lumen of the endomembrane system .

How does GAE4 expression influence pectin biosynthesis and plant development?

GAE4, as part of the GAE family, plays a crucial role in providing UDP-GalA directly to Golgi-localized galacturonosyltransferases for pectin synthesis . Studies analyzing expression patterns reveal that:

  • All GAE isoforms are expressed in developing pollen of A. thaliana

  • Different family members show differential expression in various plant tissues

  • Pectin composition is likely regulated by the tissue-specific expression of different GAE isoforms

The availability of recombinant GAE4 enables detailed investigations of pectin biosynthesis regulation, which affects cell wall structure, plant growth, and developmental processes .

What are the regulatory mechanisms controlling GAE4 activity?

Several regulatory mechanisms have been identified:

How do I troubleshoot recombinant GAE4 expression and purification issues?

Common challenges and solutions include:

ChallengePotential Solution
Low protein yieldOptimize codon usage for expression host; try different expression systems (E. coli, yeast, baculovirus)
Inclusion body formationExpress at lower temperatures (16-20°C); use solubility-enhancing tags; try cell-free expression systems
Loss of activity during purificationInclude stabilizing agents (e.g., glycerol); maintain pH around 7.5-8.0; avoid repeated freeze-thaw cycles
AggregationUse size-exclusion chromatography to isolate properly folded dimers (~88 kDa) from aggregates

For protein reconstitution after purification:

  • Briefly centrifuge the vial before opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C

How does GAE4 differ from other members of the GAE family in Arabidopsis?

While all six GAE isoforms in Arabidopsis share significant sequence homology in their catalytic domains, they differ in:

This diversity likely allows specialized control of UDP-GalA production in different tissues and developmental stages.

What is the relationship between GAE4 and gibberellin (GA) biosynthesis pathways?

Although GAE4 and GA4 share similar nomenclature, they represent different biological entities:

  • GAE4 (UDP-glucuronate 4-epimerase 4) is involved in cell wall precursor biosynthesis

  • GA4 is a bioactive gibberellin hormone involved in plant growth regulation

  • GA4 levels increase dramatically in shoot apices before flowering is initiated in short days

  • Cell wall modifications by enzymes like GAE4 may influence hormone sensitivity or transport

  • Both pathways are developmentally regulated and tissue-specific

Understanding these potential crosstalk mechanisms represents an important frontier in plant biology research.

How can molecular dynamics simulations enhance our understanding of GAE4 catalytic mechanism?

Molecular dynamics (MD) simulations can provide valuable insights into:

  • Substrate binding: Identifying key residues involved in UDP-GlcA recognition and positioning

  • Catalytic mechanism: Modeling the transient 4-keto intermediate formation and stereospecific hydride transfer

  • Regulatory interactions: Simulating how inhibitors like UDP-Xyl interact with the enzyme

Based on studies of the related B. cereus enzyme, researchers should particularly focus on:

  • The role of the conserved Tyr149 as the catalytic base for substrate oxidation

  • Conformational changes during substrate binding that may establish stereo-electronic constraints

  • Mechanisms preventing decarboxylation of the labile β-keto acid intermediate

What are promising approaches for investigating GAE4 function in planta?

Several cutting-edge strategies hold promise:

  • CRISPR/Cas9 gene editing: Generate precise mutations in GAE4 and other family members to create single, double, or higher-order mutants with potentially informative phenotypes

  • Inducible expression systems: Develop tools to control GAE4 expression temporally, allowing assessment of immediate vs. long-term effects

  • Cell-specific expression analysis: Use fluorescent reporters to track tissue-specific expression patterns during development

  • Metabolic flux analysis: Employ isotope labeling to trace the flow of carbohydrates through the UDP-GalA pathway in wild-type vs. GAE-modified plants

How might structural biology approaches advance our understanding of GAE4?

Structural determination through X-ray crystallography or cryo-EM would provide crucial insights into:

  • Substrate binding pocket architecture

  • Conformational changes during catalysis

  • Oligomerization interfaces

  • Structure-guided design of specific inhibitors

These structural data would complement existing biochemical characterization and potentially reveal:

  • The molecular basis for GAE4's preference for UDP-GlcA over other sugar nucleotides

  • The structural features preventing decarboxylation (in contrast to decarboxylases that act on the same substrate)

  • Potential protein-protein interaction surfaces that might mediate integration with other cell wall biosynthetic enzymes

What technical advances might enhance the utility of recombinant GAE4 for pectin synthesis studies?

Several innovations could advance this research area:

  • Enzyme immobilization: Developing methods to stabilize GAE4 on solid supports for continuous production of UDP-GalA

  • Coupled enzyme systems: Creating multi-enzyme cascades that convert economical starting materials to UDP-GalA for pectin synthesis studies

  • Engineered variants: Designing GAE4 mutants with altered properties (e.g., higher stability, different equilibrium constants, reduced product inhibition)

  • Real-time activity assays: Developing fluorescent or colorimetric assays for continuous monitoring of enzyme activity

Such advances would facilitate more detailed studies of pectin biosynthesis and potentially enable in vitro reconstruction of complex cell wall synthesis pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.