Recombinant Arabidopsis thaliana UDP-glucuronate 4-epimerase 5 (GAE5)

Shipped with Ice Packs
In Stock

Description

Introduction

UDP-glucuronate 4-epimerases (GAEs) catalyze the epimerization of UDP-alpha-D-glucuronic acid (UDP-GlcA) to UDP-alpha-D-galacturonic acid (UDP-GalA) . UDP-GalA is a crucial precursor in the synthesis of numerous cell-surface polysaccharides in both bacteria and plants . Within Arabidopsis thaliana, the GAE family comprises multiple isoforms, each potentially contributing uniquely to cell wall biosynthesis and development .

Identification and Cloning

Researchers have identified and cloned several GAE isoforms from Arabidopsis thaliana, including GAE5 and GAE6 . These isoforms were identified through biochemical screens and bioinformatics approaches, leveraging sequence similarity to known bacterial enzymes .

Biochemical Characterization

Recombinant GAEs, such as AtUGlcAE1 (isoform 1), have been biochemically characterized to understand their enzymatic properties . The recombinant epimerase has a predicted molecular mass of approximately 43 kD, but it may exist as a dimer of approximately 88 kD as suggested by size-exclusion chromatography .

Key biochemical characteristics include:

  • Catalyzing the formation of UDP-GalA from UDP-GlcA with an equilibrium constant of approximately 1.9 .

  • Having an apparent $$K_m$$ value of 720 µM for UDP-GlcA .

  • Exhibiting maximum activity at pH 7.5 and being active between 20°C and 55°C .

  • Inhibition by UDP-Xyl and UDP-Ara, suggesting a role for these nucleotide sugars in regulating pectin synthesis .

Expression Analysis

Expression analyses, including quantitative RT-PCR and promoter::GUS fusions, have indicated differential expression of GAE family members in various plant tissues, including developing pollen .

Functional Significance

GAEs play a vital role in plant cell wall biosynthesis, specifically in the production of pectic polysaccharides . These polysaccharides are crucial for cell wall structure, cell adhesion, and various developmental processes .

Regulatory Role

The activity of GAEs can be influenced by various factors, including nucleotide sugars such as UDP-Xyl and UDP-Ara, which act as inhibitors . This suggests a complex regulatory mechanism that fine-tunes pectin synthesis in response to developmental and environmental cues .

Potential Biotechnological Applications

The availability of functional recombinant UDP-GlcA 4-epimerases facilitates the generation of UDP-d-GalA in quantities sufficient for detailed studies of pectin biosynthesis . Furthermore, UDP-glucuronate 5-epimerase (UGA5E) could be useful for the synthesis of UDP-l-iduronate .

GAE Isoforms

IsoformAlternate NameGene
GAE1AtUGlcAE1AT4G30440
GAE2Q9LPC1
GAE6

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GAE5; At4g12250; T4C9.90; UDP-glucuronate 4-epimerase 5; UDP-glucuronic acid epimerase 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-436
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
GAE5
Target Protein Sequence
MSHLDDLPSTPGKYKTDKVPPYGILHHHRYLRLSKLTLWASLFLALFLFYLVLSPPPSPS RRNLNDSSSISAAKYGGSHWEKQVRKSARPRSHGGLTVLVTGASGFVGTHVSIALRRRGD GVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLRKLFDVVLFTHVMHLAAQ AGVRYAMQNPGSYVNSNIAGFVNLLEVSKSANPQPAIVWASSSSVYGLNSKVPFSEKDRT DQPASLYAATKKAGEGIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFTKDILKGKT ITVFESPDKGSVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAMFRIYNLGNTSPV PVTKLVTILEKLLKMKAKKKIMPLPRNGDVEFTHANITLAQAELGYKPAVDLETGLKKFV KWYMGFYTGSKKKSSW
Uniprot No.

Target Background

Function

Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components.

Database Links

KEGG: ath:AT4G12250

STRING: 3702.AT4G12250.1

UniGene: At.48849

Protein Families
NAD(P)-dependent epimerase/dehydratase family
Subcellular Location
Golgi apparatus, Golgi stack membrane; Multi-pass membrane protein.
Tissue Specificity
In leaves, pollen and siliques, but not in roots or flowers.

Q&A

What is UDP-glucuronate 4-epimerase 5 (GAE5) in Arabidopsis thaliana?

UDP-glucuronate 4-epimerase 5 (GAE5) is one of six isoforms of UDP-D-glucuronate 4-epimerase encoded in the Arabidopsis thaliana genome. It belongs to a family of enzymes that catalyze the reversible interconversion of UDP-D-glucuronate to UDP-D-galacturonate, which serves as an activated precursor necessary for the synthesis of pectic polysaccharides in plant cell walls. GAE5, like other GAE isoforms, is predicted to be a type II membrane protein that belongs to the short-chain dehydrogenase/reductase family of enzymes. The enzyme is integral to pectin biosynthesis, as D-galacturonate is the dominant monosaccharide in pectic polysaccharides and contributes significantly to the structural integrity of plant cell walls .

How many UDP-glucuronate 4-epimerase isoforms exist in Arabidopsis thaliana?

Arabidopsis thaliana possesses six isoforms of UDP-D-glucuronate 4-epimerase, designated as GAE1 through GAE6. These isoforms were identified through bioinformatics approaches based on sequence similarity to bacterial UDP-D-glucuronate 4-epimerases. All six isoforms are predicted to have similar catalytic functions but exhibit differential expression patterns across various plant tissues, suggesting specialized roles in specific developmental contexts or cell types. The presence of multiple isoforms indicates potential functional redundancy as well as possible tissue-specific specialization within the GAE family .

What is the reaction catalyzed by UDP-glucuronate 4-epimerase 5?

UDP-glucuronate 4-epimerase 5 catalyzes the reversible interconversion between UDP-D-glucuronate and UDP-D-galacturonate:

UDP-D-glucuronate ⇌ UDP-D-galacturonate

This epimerization reaction involves the inversion of stereochemistry at the C4 position of the sugar moiety. The reaction mechanism likely involves oxidation of the C4 hydroxyl group to a keto intermediate by NAD+ (which remains tightly bound to the enzyme), followed by rotation of the intermediate and subsequent reduction back to a hydroxyl group with inverted stereochemistry. This mechanism is similar to that observed in other epimerase enzymes, such as UDP-galactose 4-epimerase from E. coli, which follows a comparable reaction pathway involving NAD+ as a cofactor .

Where is GAE5 expressed in Arabidopsis thaliana tissues?

While specific expression data exclusively for GAE5 is limited in the provided search results, studies have shown that the GAE family members in Arabidopsis exhibit differential expression patterns across various plant tissues. Expression analysis using quantitative RT-PCR and promoter::GUS fusions has demonstrated that all GAE isoforms, including GAE5, are expressed in developing pollen of Arabidopsis thaliana. Other family members show tissue-specific expression patterns, suggesting that GAE5 likely has its own distinct expression profile that may overlap with or complement those of other GAE isoforms. This differential expression across tissues indicates specialized roles for each GAE in plant development and cell wall synthesis in specific cell types .

What are the biochemical properties of recombinant GAE5?

Recombinant GAE5, like other characterized GAE isoforms, functions as a UDP-D-glucuronate 4-epimerase that catalyzes the reversible interconversion between UDP-D-glucuronate and UDP-D-galacturonate. Based on studies of related GAE isoforms such as GAE1, we can infer several biochemical properties of GAE5:

  • Cofactor requirement: GAE5 likely requires NAD+ as a cofactor, which remains tightly bound during catalysis.

  • Equilibrium constant: GAE isoforms typically establish an equilibrium between UDP-D-galacturonate and UDP-D-glucuronate. For instance, GAE1 establishes a 1.3:1 equilibrium between UDP-D-galacturonate and UDP-D-glucuronate.

  • Substrate specificity: GAE5 is likely highly specific for UDP-D-glucuronate and UDP-D-galacturonate, and does not epimerize other UDP-sugars such as UDP-D-glucose or UDP-D-xylose.

  • Inhibition profile: Based on GAE1 studies, GAE5 may be inhibited by UDP-D-xylose but not by UDP, UDP-D-glucose, or UDP-D-galactose.

  • Membrane association: As a predicted type II membrane protein, GAE5 activity is likely associated exclusively with microsomal fractions rather than soluble cellular components .

How does the structure of GAE5 compare to other epimerases?

While the specific three-dimensional structure of GAE5 has not been fully elucidated, insights can be drawn from related epimerases and sequence analyses:

  • Domain organization: GAE5, like other plant GAEs, is predicted to be a type II membrane protein with an N-terminal transmembrane domain and a C-terminal catalytic domain that resides in the lumen of the endomembrane system.

  • Structural homology: The catalytic domain of GAE5 likely adopts a fold similar to that of the short-chain dehydrogenase/reductase (SDR) family, with a Rossmann fold for NAD+ binding and a substrate-binding domain.

  • Comparison to bacterial epimerases: Unlike bacterial UDP-D-glucuronate 4-epimerases, which are soluble enzymes, plant GAEs including GAE5 contain an N-terminal transmembrane domain, suggesting evolutionary adaptation for direct provision of UDP-D-galacturonate to Golgi-localized galacturonosyltransferases involved in pectin synthesis.

  • Active site architecture: Based on studies of UDP-galactose 4-epimerase from E. coli, the active site of GAE5 likely accommodates various sugar conformations through rearrangements of water molecules rather than through large changes in side chain conformations .

What methods can be used to express and purify recombinant GAE5?

Based on successful approaches used for other GAE isoforms, the following methods can be employed for expression and purification of recombinant GAE5:

  • Expression system selection: Pichia pastoris has been successfully used for expression of GAE1 and would likely be suitable for GAE5 as well. This yeast expression system allows for proper protein folding and post-translational modifications that might be essential for GAE activity.

  • Construct design:

    • Include the full-length coding sequence with the N-terminal transmembrane domain for native functionality

    • Alternatively, design a truncated version lacking the transmembrane domain for improved solubility

    • Add an affinity tag (His-tag, GST, etc.) for purification purposes

  • Membrane protein extraction: Use detergents such as CHAPS (4% v/v) for solubilization of the membrane-bound enzyme from microsomal fractions.

  • Purification strategy:

    • Prepare microsomes from transgenic expression systems

    • Solubilize with appropriate detergents

    • Employ affinity chromatography based on the chosen tag

    • Consider ion exchange chromatography as a secondary purification step

    • Validate purified protein by SDS-PAGE and Western blot

  • Activity preservation: Maintain appropriate buffer conditions and consider adding glycerol or other stabilizing agents to preserve enzyme activity during purification and storage .

How can GAE5 activity be measured in vitro?

GAE5 activity can be assessed using several complementary approaches:

  • Radiochemical assay:

    • Incubate the enzyme with UDP-[14C]glucuronate as substrate

    • Stop the reaction at various time points

    • Hydrolyze the UDP-sugars to release the monosaccharides

    • Separate glucuronic acid and galacturonic acid by thin-layer chromatography (TLC)

    • Quantify radioactivity in each spot to determine the extent of conversion

  • HPLC-based analysis:

    • React purified GAE5 with UDP-D-glucuronate

    • Separate UDP-D-glucuronate and UDP-D-galacturonate by HPLC

    • Quantify both compounds using UV detection at 260 nm

    • Calculate conversion rates and equilibrium constants

  • Coupled enzyme assay:

    • Design a coupled assay where the production of UDP-D-galacturonate is linked to a second enzyme reaction with spectrophotometric readout

    • Monitor the reaction progress continuously through changes in absorbance

  • Enzyme kinetics determination:

    • Measure initial reaction rates at various substrate concentrations

    • Determine Km, Vmax, and catalytic efficiency (kcat/Km)

    • Assess the effects of potential inhibitors and activators

  • pH and temperature optimization:

    • Determine the optimal pH for activity (likely around 7.6 based on GAE1)

    • Establish temperature optima and stability profiles .

What expression systems are optimal for producing active recombinant GAE5?

Several expression systems can be considered for producing active recombinant GAE5, each with specific advantages and limitations:

  • Pichia pastoris expression system:

    • Demonstrated success for GAE1 expression

    • Advantages: Proper protein folding, post-translational modifications, high cell density cultures

    • Considerations: Optimize induction conditions, culture media composition, and harvest time

    • Protocol details: Transform Pichia with expression vector containing GAE5 under control of AOX1 promoter; induce with methanol; harvest cells and prepare microsomes

  • Bacterial expression systems:

    • Escherichia coli-based expression

    • Advantages: Simple, rapid, high yield

    • Limitations: Lack of post-translational modifications, potential improper folding for membrane proteins

    • Optimization strategies: Use specialized E. coli strains (C41, C43) designed for membrane protein expression; co-express with chaperones; lower induction temperature

  • Insect cell expression systems:

    • Baculovirus-infected insect cells

    • Advantages: Post-translational modifications, proper folding of complex proteins

    • Considerations: Optimize viral titer, infection time, and harvest parameters

  • Plant-based expression systems:

    • Nicotiana benthamiana transient expression

    • Advantages: Native environment for plant proteins, proper post-translational modifications

    • Protocol: Agrobacterium-mediated transformation with optimized vectors for transient expression

  • Mammalian cell expression:

    • HEK293 or CHO cells

    • Advantages: Sophisticated folding machinery, complex glycosylation

    • Limitations: Higher cost, lower yield, longer timeline

For optimal GAE5 expression, a comparison table can guide system selection:

Expression SystemProtein FoldingPost-translational ModificationsYieldMembrane Protein SuitabilityTime RequiredRelative Cost
Pichia pastorisGoodModerateHighGoodModerateLow-Medium
E. coliLimitedMinimalHighLimitedShortLow
Insect cellsGoodGoodModerateGoodModerateMedium
Plant systemsExcellentExcellentModerateExcellentModerateMedium
Mammalian cellsExcellentExcellentLowGoodLongHigh

Based on previous success with GAE1 and the properties of GAE5 as a membrane-bound enzyme, Pichia pastoris represents the optimal balance of proper protein folding, reasonable yield, and established protocols for functional expression .

How can site-directed mutagenesis be used to study GAE5 function?

Site-directed mutagenesis offers a powerful approach to investigate structure-function relationships in GAE5:

  • Key residues for targeted mutagenesis:

    • NAD+ binding pocket residues: Identify and mutate conserved residues predicted to interact with the nicotinamide cofactor

    • Catalytic residues: Target amino acids potentially involved in abstracting protons from the 4'-hydroxyl group of the sugar

    • Substrate binding residues: Modify residues that confer specificity for UDP-D-glucuronate over other UDP-sugars

    • Transmembrane domain: Introduce mutations to study membrane association requirements

  • Mutagenesis workflow:

    • Perform sequence alignment with other characterized epimerases to identify conserved residues

    • Design mutagenic primers containing desired substitutions

    • Use PCR-based methods (e.g., QuikChange) to introduce mutations

    • Verify mutations by DNA sequencing

    • Express and purify mutant proteins

    • Analyze effects on enzyme activity, substrate binding, and protein stability

  • Structure-function analysis approaches:

    • Conservative vs. non-conservative substitutions to probe residue requirements

    • Alanine-scanning mutagenesis to systematically evaluate contribution of specific residues

    • Domain swapping with other GAE isoforms to identify regions conferring unique properties

  • Specific mutations of interest based on related epimerases:

    • Modify residues equivalent to those in the UDP-galactose 4-epimerase active site that affect the rotation of the 4-ketopyranose intermediate

    • Target residues that might be involved in the observed inhibition by UDP-D-xylose

    • Introduce mutations in the predicted transmembrane domain to assess its role in localization and activity

  • Analytical methods for mutant characterization:

    • Compare kinetic parameters (Km, Vmax, kcat) of wild-type and mutant enzymes

    • Assess substrate specificity changes through competitive assays

    • Examine protein stability and folding through thermal denaturation studies

    • Analyze subcellular localization of GFP-tagged mutants .

What are the considerations for designing GAE5 promoter-reporter constructs?

Developing effective GAE5 promoter-reporter constructs requires careful design considerations:

  • Promoter region definition:

    • Include sufficient upstream sequence (typically 1.5-2 kb) to capture all regulatory elements

    • Consider including the 5' untranslated region (5' UTR) which may contain regulatory elements

    • Identify and include potential enhancer regions through comparative genomics with other GAE genes

  • Reporter gene selection:

    • β-Glucuronidase (GUS): Provides sensitive histochemical detection in plant tissues

    • Green Fluorescent Protein (GFP): Enables live imaging and subcellular localization studies

    • Luciferase (LUC): Allows quantitative measurement and real-time monitoring of expression

    • Consider dual reporter systems for normalization purposes

  • Vector design considerations:

    • Include appropriate plant selectable markers for stable transformation

    • Ensure compatibility with Agrobacterium-mediated transformation

    • Consider Gateway or similar cloning technologies for flexibility in construct generation

  • Controls and validation:

    • Include positive controls with constitutive promoters (e.g., CaMV 35S)

    • Design negative controls lacking the promoter region

    • Validate construct functionality in transient expression systems before stable transformation

  • Transformation and analysis strategy:

    • Generate multiple independent transgenic lines to account for position effects

    • Perform detailed histochemical and quantitative analyses across tissues and developmental stages

    • Compare GAE5 promoter activity with other GAE isoforms to identify unique expression patterns

    • Analyze promoter activity under various stress conditions and hormone treatments

Based on previous studies of GAE isoforms, it would be particularly important to examine GAE5 promoter activity in developing pollen and other reproductive tissues, as all GAE isoforms have shown expression in these tissues .

How can conflicting results in GAE5 expression studies be reconciled?

Researchers may encounter discrepancies in GAE5 expression data from different experimental approaches. The following methodological framework can help reconcile conflicting results:

  • Systematic comparison of methodologies:

    • Compare sample preparation methods (tissue harvesting, RNA extraction protocols)

    • Assess differences in detection sensitivities between techniques (RT-PCR vs. microarray vs. RNA-seq)

    • Evaluate normalization methods and reference genes used

    • Consider temporal and spatial differences in sampling

  • Multi-technique validation approach:

    • Validate expression patterns using complementary techniques (qRT-PCR, in situ hybridization, promoter-reporter constructs)

    • Confirm protein expression using immunolocalization or proteomics approaches

    • Correlate expression data with enzyme activity measurements in corresponding tissues

  • Biological factors affecting expression:

    • Growth conditions: Light intensity, photoperiod, temperature, nutrient availability

    • Developmental stage: Precise developmental timing even within the same tissue type

    • Circadian regulation: Time of day when samples were collected

    • Stress responses: Inadvertent stress during growth or sample collection

  • Statistical approaches for data integration:

    • Meta-analysis of multiple datasets using appropriate statistical methods

    • Bayesian integration approaches for reconciling diverse data types

    • Development of consensus expression profiles weighted by methodological reliability

  • Experimental design for resolution:

    • Design targeted experiments to specifically address contradictory findings

    • Use higher resolution techniques (single-cell RNA-seq) to address cellular heterogeneity

    • Employ time-course studies to capture dynamic expression changes

When analyzing expression data for GAE5, particular attention should be paid to its potential differential expression across tissues and developmental stages, as studies have shown that GAE family members exhibit distinct tissue-specific expression patterns in Arabidopsis thaliana .

How can GAE5 activity assays be normalized across different experimental conditions?

Proper normalization of GAE5 activity assays is essential for meaningful comparisons across different experimental conditions:

  • Protein-based normalization strategies:

    • Total protein normalization: Express activity per mg of total protein

    • Specific activity determination: Calculate units of enzyme activity per mg of purified enzyme

    • Immunoquantification: Use Western blotting with GAE5-specific antibodies to quantify enzyme amount

    • Tagged recombinant protein: Utilize affinity tags for precise quantification of recombinant enzyme

  • Internal controls and standards:

    • Include known amounts of purified reference enzymes in parallel assays

    • Use internal standard curves with defined amounts of UDP-D-galacturonate

    • Run consistent positive and negative controls across experimental batches

    • Employ spike-in controls with known activity to assess recovery and matrix effects

  • Assay conditions standardization:

    • Maintain consistent temperature, pH, buffer composition, and ionic strength

    • Standardize substrate concentrations and purity specifications

    • Control for the presence of potential inhibitors or activators

    • Account for equilibrium shifts under different conditions

  • Data representation and statistical analysis:

    • Express results as specific activity, turnover number (kcat), or catalytic efficiency (kcat/Km)

    • Calculate and report confidence intervals for all measurements

    • Use appropriate statistical tests to determine significance of observed differences

    • Apply transformation methods for non-normally distributed data if necessary

  • Adjustment for membrane-associated enzyme challenges:

    • Normalize to total microsomal protein when working with membrane preparations

    • Account for differences in detergent solubilization efficiency

    • Consider lipid composition effects on enzyme activity

    • Correct for potential loss of activity during membrane preparation

A standardized protocol might involve:

  • Preparing microsomes under identical conditions

  • Solubilizing with 4% CHAPS or similar detergent

  • Determining total protein concentration by Bradford or BCA assay

  • Incubating with UDP-[14C]GlcUA under standardized conditions

  • Analyzing reaction products by TLC and quantifying radioactivity

  • Expressing activity as pmol UDP-GalUA formed per minute per mg protein .

What are the challenges in interpreting GAE5 mutant phenotypes?

Interpreting phenotypes of GAE5 mutants presents several challenges that researchers should systematically address:

  • Functional redundancy complications:

    • The presence of six GAE isoforms in Arabidopsis may mask phenotypes in single gene knockouts

    • Consider generating higher-order mutants (double, triple, etc.) to overcome redundancy

    • Use tissue-specific or inducible knockdown/knockout approaches to bypass potential lethality

  • Pleiotropic effects interpretation:

    • GAE5 affects pectin biosynthesis, which impacts multiple developmental processes

    • Distinguish primary (direct) from secondary (indirect) phenotypic effects

    • Use complementation studies with tissue-specific promoters to dissect spatial requirements

  • Cell wall composition analysis challenges:

    • Develop sensitive methods to detect potentially subtle changes in pectin composition

    • Account for compensatory changes in other cell wall components

    • Consider developmental timing of analysis, as effects may be stage-specific

  • Experimental approaches for robust phenotyping:

    • Combine genetic approaches (T-DNA insertions, CRISPR/Cas9) with RNAi or artificial microRNA technologies

    • Use conditional mutants or chemical genetics approaches for temporal control

    • Apply cell-type specific promoters for tissue-targeted modification of GAE5 expression

  • Validation strategies:

    • Perform genetic complementation with wild-type GAE5 to confirm phenotype causality

    • Use domain swapping between GAE isoforms to identify functionally unique regions

    • Conduct site-directed mutagenesis of conserved residues to create separation-of-function alleles

Given that GAE isoforms show differential expression patterns across tissues but with all isoforms expressed in developing pollen, particular attention should be paid to reproductive phenotypes in GAE5 mutants, while also examining potential compensatory changes in expression of other GAE family members .

How can GAE5 contributions be distinguished from those of other GAE isoforms in vivo?

Distinguishing the specific contributions of GAE5 from other GAE isoforms requires multifaceted approaches:

  • Genetic approaches:

    • Generate and characterize gae5 single mutants

    • Create combinatorial mutants of GAE5 with other GAE genes

    • Develop a complete set of higher-order mutants to assess additive or synergistic effects

    • Perform complementation studies with GAE5 in various mutant backgrounds

  • Expression pattern analysis:

    • Compare detailed tissue-specific and developmental expression patterns of all GAE isoforms

    • Identify tissues or developmental stages where GAE5 is uniquely or predominantly expressed

    • Focus functional analyses on tissues with GAE5-specific expression

  • Biochemical characterization:

    • Compare substrate specificities, kinetic parameters, and inhibition profiles of all recombinant GAE isoforms

    • Identify unique biochemical properties of GAE5 that might indicate specialized functions

    • Develop isoform-specific activity assays based on unique catalytic properties

  • Cell-specific approaches:

    • Use cell-type specific promoters to express GAE5 in different cellular contexts

    • Employ laser capture microdissection to isolate specific cells for analysis

    • Develop single-cell approaches to study GAE5 function in specific cell types

  • Data integration strategy:

    • Correlate GAE5 expression patterns with specific cell wall properties across tissues

    • Integrate transcriptomic, proteomic, and metabolomic data to build GAE5-specific networks

    • Develop computational models of pectin biosynthesis incorporating differential activities of GAE isoforms

The differential expression patterns observed for GAE family members suggest functional specialization. Focus on developing pollen may be particularly informative since all GAE isoforms are expressed there, potentially allowing for comparative studies of their relative contributions to pollen development and function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.