Recombinant Arabidopsis thaliana UDP-glucuronate 4-epimerase 6 (GAE6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
GAE6; UGlcAE2; At3g23820; F14O13.1; UDP-glucuronate 4-epimerase 6; UDP-glucuronic acid epimerase 6; AtUGlcAE2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-460
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
GAE6
Target Protein Sequence
MPLSATADTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLIFAINYPPL SDSRAAAAHHLHRRSFLSTGLFSSSSSSSSIGGAAWEKRVRQSSTAKRPHGLSVLVTGAA GFVGSHCSLALRKRGDGVLGFDNFNDYYDPSLKRARQELLEKQQVFIVEGDLNDGPLLRK LFDVVPFTHILHLAAQAGVRYAMKNPQSYIASNIAGFVNLLEVAKAANPQPAIVWASSSS VYGLNTENPFSEEHRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRP DMAYFFFTKDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKR GQAQLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYKDF GYKPTTDLAAGLRKFVKWYVGYYGIQPRVKKETSHAEDSA
Uniprot No.

Target Background

Function

This protein is involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components.

Database Links

KEGG: ath:AT3G23820

STRING: 3702.AT3G23820.1

UniGene: At.24934

Protein Families
NAD(P)-dependent epimerase/dehydratase family
Subcellular Location
Golgi apparatus, Golgi stack membrane; Multi-pass membrane protein.
Tissue Specificity
In roots, leaf veins, siliques, flowers, pollen and stems.

Q&A

What is UDP-glucuronate 4-epimerase 6 (GAE6) and what is its primary function?

UDP-glucuronate 4-epimerase 6 (GAE6) is an enzyme that catalyzes the conversion of UDP-α-D-glucuronic acid (UDP-GlcA) to UDP-α-D-galacturonic acid (UDP-GalA) in plants . This epimerization reaction is critical for plant cell wall biosynthesis, particularly in the production of pectic polysaccharides, as D-galacturonate is one of the dominant monosaccharides in these structural components . The enzyme functions by mediating the reversible stereochemical inversion at the C4 position of the substrate. This catalytic activity plays a fundamental role in providing activated precursors necessary for pectin synthesis, which is essential for proper plant development and cell wall integrity .

How is GAE6 structurally characterized in Arabidopsis thaliana?

GAE6 in Arabidopsis thaliana belongs to a family of UDP-GlcA epimerases that includes six isoforms . All members of this gene family encode putative type-II membrane proteins with a distinctive two-domain structure . The protein contains:

  • A variable N-terminal region approximately 120 amino acids long, which consists of:

    • A predicted cytosolic domain

    • A transmembrane domain

    • A stem domain

  • A large conserved C-terminal catalytic region approximately 300 amino acids long, which contains:

    • A highly conserved catalytic domain found in the broader epimerase/dehydratase protein family

The recombinant form of the enzyme has a predicted molecular mass of approximately 43 kDa, although size-exclusion chromatography suggests it may exist as a dimer (approximately 88 kDa) in its functional state . The protein also contains the characteristic GxxGxxG motif within the N-terminal domain, which is likely involved in nucleotide binding, a feature common to many nucleotide-sugar epimerases .

What is the genomic context of GAE6 in the Arabidopsis genome?

GAE6 is one of six homologous genes encoding UDP-D-glucuronate 4-epimerase enzymes in the Arabidopsis thaliana genome . The gene is also known by alternative names including UGlcAE2 and At3g23820, with the latter indicating its location on chromosome 3 . Expression analysis has revealed differential expression patterns among the family members across various plant tissues, with all isoforms showing expression in developing pollen . This genomic diversity and tissue-specific expression profile suggest specialized roles for different GAE isoforms in plant development and cell wall biosynthesis.

What are the optimal conditions for GAE6 enzymatic activity?

Based on biochemical characterization studies, recombinant Arabidopsis GAE enzyme displays specific optimal conditions for activity:

ParameterOptimal ValueActivity RangeNotes
pH7.5Not specifiedMaximum enzymatic activity occurs at this pH value
TemperatureNot specified20°C - 55°CThe enzyme maintains activity across this temperature range
Equilibrium Constant~1.9-Favors the formation of UDP-GalA over UDP-GlcA
Apparent Km for UDP-GlcA720 μM-Indicates moderate affinity for the substrate

These biochemical parameters are critical for designing experimental protocols that maximize enzymatic activity in vitro and for understanding the enzyme's behavior in vivo during plant cell wall biosynthesis .

How does GAE6 contribute to the biosynthesis pathway of pectin in plant cell walls?

GAE6 plays a crucial role in the pectin biosynthesis pathway by catalyzing the conversion of UDP-GlcA to UDP-GalA . This reaction is critical because UDP-GalA serves as one of the primary activated precursors for pectin synthesis in plant cell walls . The pathway proceeds as follows:

  • UDP-glucose is first oxidized to form UDP-glucuronic acid (UDP-GlcA)

  • GAE6 and other UDP-GlcA 4-epimerase isoforms convert UDP-GlcA to UDP-galacturonic acid (UDP-GalA)

  • UDP-GalA serves as the activated donor for the incorporation of galacturonic acid residues into pectic polysaccharides

The availability of functional recombinant UDP-GlcA 4-epimerase enables the generation of UDP-GalA in quantities necessary for detailed studies of pectin biosynthesis . This enzyme's activity represents a key regulatory point in determining the composition and properties of the plant cell wall, affecting both structural integrity and developmental processes .

What is the substrate specificity of GAE6 and how does it compare to other epimerases?

GAE6 demonstrates high substrate specificity for UDP-uronic acids. Experimental testing reveals:

SubstrateActivityNotes
UDP-GlcAActivePrimary forward reaction substrate
UDP-GalAActivePrimary reverse reaction substrate, with equilibrium favoring UDP-GalA formation (Keq ≈ 1.9)
UDP-GlcInactiveNot a substrate
UDP-GalInactiveNot a substrate
UDP-AraInactiveActs as an inhibitor
UDP-XylInactiveActs as an inhibitor
CDP-GlcInactiveNot a substrate
GDP-ManInactiveNot a substrate

This narrow substrate specificity distinguishes GAE6 from other nucleotide-sugar epimerases such as UDP-glucose 4-epimerase, which interconverts UDP-glucose and UDP-galactose . The high specificity for UDP-uronic acids is consistent with GAE6's specialized role in pectin biosynthesis .

How is GAE6 expression regulated in different plant tissues and developmental stages?

Quantitative RT-PCR and promoter::GUS fusion studies have revealed that GAE6 and its five homologs in the Arabidopsis genome exhibit differential expression patterns across various plant tissues . Key findings include:

  • All six GAE isoforms show expression in developing pollen of Arabidopsis thaliana

  • Each family member displays a distinct tissue-specific expression pattern, suggesting specialized roles in different developmental contexts

  • This differential expression likely allows for precise regulation of pectin composition across different plant tissues and developmental stages

The tissue-specific expression profile suggests that GAE6 activity is carefully regulated at the transcriptional level, with expression patterns matching the pectin requirements of specific tissues during development . Understanding these expression patterns can provide insights into the functional specialization of different GAE isoforms in cell wall biogenesis.

What factors inhibit or enhance GAE6 enzymatic activity?

Biochemical studies have identified several regulatory factors that affect GAE6 activity:

FactorEffectMechanism/Significance
UDP-XylInhibitionSuggests regulatory role in pectin synthesis
UDP-AraInhibitionSuggests regulatory role in pectin synthesis
UDP-GlcNo inhibitionDoes not affect enzyme activity
UDP-GalNo inhibitionDoes not affect enzyme activity
UMPNo inhibitionDoes not affect enzyme activity
NAD+Not requiredEnzyme does not require exogenous NAD+ for activity

The inhibition by UDP-Xyl and UDP-Ara suggests a feedback regulatory mechanism where these nucleotide sugars, which are involved in other cell wall polysaccharide biosynthesis pathways, may modulate pectin synthesis . This cross-talk between different cell wall biosynthesis pathways could allow for coordinated regulation of cell wall composition in response to developmental and environmental cues.

What are the recommended protocols for producing and purifying recombinant GAE6?

Based on published literature, recombinant GAE6 can be produced using several expression systems. Recommended protocols include:

Expression SystemProtein FormPurification MethodPurity LevelReference
Cell-Free ExpressionFull-lengthNot specified≥85% as determined by SDS-PAGE
E. coliPartialNot specified≥85% as determined by SDS-PAGE
E. coliFull-length with His-tagNot specifiedNot specified

For functional studies, a truncated form (Δ1–64) lacking the N-terminal membrane-spanning domain has been successfully used . The recombinant protein can be purified using affinity chromatography when tagged, followed by size-exclusion chromatography to obtain active enzyme . For optimal activity, the enzyme should be stored in appropriate buffer conditions that maintain its dimeric structure and stability .

In Vitro Assays:

  • Capillary Electrophoresis (CE):

    • This technique can be used to separate and quantify UDP-GlcA and UDP-GalA

    • The reaction progress can be monitored by analyzing the relative concentrations of substrate and product over time

  • Enzymatic Coupled Assays:

    • Measuring the equilibrium constant by incubating the enzyme with UDP-GlcA for various times and determining the UDP-GalA/UDP-GlcA ratio

    • The equilibrium constant of approximately 1.9 indicates that the reaction favors UDP-GalA formation

In Planta Assays:

  • Expression Analysis:

    • Quantitative RT-PCR to measure transcript levels in different tissues and under various conditions

    • Promoter::GUS fusion studies to visualize spatial expression patterns

  • Functional Analysis:

    • Generation of knockout or overexpression lines to study the impact on cell wall composition

    • Analysis of pectin content and structure in these modified lines to correlate with GAE6 activity

These methodologies provide complementary approaches to understand both the biochemical properties of the enzyme and its biological function in the context of plant development and cell wall biosynthesis.

What is the evolutionary relationship between plant UDP-GlcA epimerases and similar enzymes in other organisms?

UDP-GlcA epimerases represent a specialized subgroup within the larger family of nucleotide-sugar epimerases that are found across various organisms. Evolutionary analysis reveals:

  • Plant UDP-GlcA epimerases share significant sequence similarity with the cap1J gene product from Streptococcus pneumoniae, which was identified as encoding an active UDP-GlcA epimerase

  • The GAE family belongs to a large protein family of epimerases/dehydratases with conserved catalytic motifs, including the GxxGxxG sequence within the N-terminal domain involved in nucleotide binding

  • Comparative analysis suggests that most nucleotide-sugar 4-epimerases evolved from a common ancestor, with specialized functions developing to meet organism-specific polysaccharide biosynthesis needs

  • The presence of multiple GAE isoforms in plants (six in Arabidopsis) likely resulted from gene duplication events, allowing for functional specialization and tissue-specific expression patterns

This evolutionary perspective helps contextualize the specialized role of plant GAE enzymes in cell wall biosynthesis and provides insights into the conservation of fundamental enzymatic mechanisms across diverse organisms.

How can omics approaches enhance our understanding of GAE6 function in plant metabolism?

Omics approaches offer powerful tools for elucidating GAE6 function within the broader context of plant metabolism and development:

These integrated approaches can provide a comprehensive understanding of how GAE6 contributes to plant cell wall biosynthesis and plant development at multiple organizational levels.

How might CRISPR/Cas9 gene editing be applied to study GAE6 function?

CRISPR/Cas9 technology offers precise gene editing capabilities that can be strategically applied to study GAE6 function:

  • Targeted Mutations:

    • Creation of knockout lines by introducing frameshift mutations or premature stop codons

    • Generation of specific amino acid substitutions to study the functional importance of conserved catalytic residues

    • Development of conditional knockouts using inducible promoters to study GAE6 function at specific developmental stages

  • Promoter Modifications:

    • Alteration of the native promoter to study the effects of modified expression patterns

    • Integration of reporter genes to visualize real-time expression dynamics in different tissues and under various conditions

  • Multi-gene Editing:

    • Simultaneous targeting of multiple GAE family members to overcome potential functional redundancy

    • Creation of combinatorial mutants to study synergistic effects and pathway interactions

  • Domain Swapping:

    • Precise engineering to exchange domains between different GAE isoforms to study functional specificity

    • Introduction of domains from related epimerases to investigate substrate specificity determinants

These approaches would provide unprecedented insights into GAE6 function and its role in pectin biosynthesis, potentially revealing new strategies for modifying plant cell wall properties for agricultural and industrial applications.

What are the implications of GAE6 research for improving plant biomass properties?

Research on GAE6 and related enzymes in the pectin biosynthesis pathway has significant implications for modifying plant biomass properties:

  • Bioenergy Applications:

    • Modifying pectin content and structure could enhance biomass digestibility for biofuel production

    • Engineered changes in cell wall composition might reduce recalcitrance to enzymatic breakdown

  • Agricultural Improvements:

    • Targeted modifications of pectin structure could enhance plant resilience to environmental stresses

    • Changes in cell wall properties might improve water use efficiency and drought tolerance

  • Industrial Applications:

    • Enhanced pectin production could benefit industries using pectin as a gelling agent, stabilizer, or thickener

    • Designer pectins with specific properties could be developed for specialized applications

  • Fundamental Understanding:

    • Deeper knowledge of GAE6 function contributes to our understanding of plant cell wall biosynthesis

    • This basic research forms the foundation for future applied technologies

The strategic manipulation of GAE6 and related enzymes represents a promising approach for tailoring plant biomass properties to meet specific agricultural, industrial, and environmental challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.