Recombinant Arabidopsis thaliana UDP-glucuronate:xylan alpha-glucuronosyltransferase 2 (GUX2)

Shipped with Ice Packs
In Stock

Description

Protein Structure

GUX2 belongs to Glycosyltransferase Family 8 (GT8) and contains conserved motifs critical for enzymatic activity. Key features include:

  • Length: Full-length protein (1–596 amino acids) .

  • Tag: N-terminal His tag for affinity purification .

  • Localization: Golgi apparatus, consistent with its role in xylan synthesis .

ParameterValue/DescriptionSource
Source OrganismArabidopsis thaliana
Host SystemE. coli
Purity>85% (SDS-PAGE)
Storage BufferTris/PBS-based, 6% trehalose, pH 8.0
UniProt IDQ8GWW4

Functional Roles in Xylan Biosynthesis

GUX2 catalyzes the transfer of GlcA from UDP-GlcA to the xylan backbone, forming α(1,2)-linked glucuronosyl substitutions. Unlike GUX1, which adds GlcA at evenly spaced intervals, GUX2 generates clustered substitutions, often spaced 5–7 xylose residues apart .

Key Differences Between GUX1 and GUX2

FeatureGUX1GUX2
Substitution PatternEven spacing (8–10 xylose residues)Clustered (5–7 residues)
Domain SpecificityMajor domain of xylanMinor domain of xylan
Impact on Xylan StructurePromotes interaction with celluloseFacilitates interaction with lignin

Biochemical Activity

  • Substrate Preference: Strongly favors xylohexaose over shorter oligosaccharides .

  • Donor Specificity: Utilizes UDP-GlcA as the nucleotide sugar donor .

  • Mutational Insights:

    • SRF Motif: In gymnosperms (e.g., PtGUX2), an SRF motif enables consecutive GlcA additions, absent in angiosperms like Arabidopsis .

    • Chimera Studies: Swapping N-terminal regions between GUX1 and GUX2 alters activity and substitution patterns, indicating domain-specific roles in enzymatic function .

Phenotypic Effects of Mutants

MutantPhenotypeSource
gux1Reduced GlcA substitution, impaired secondary wall thickening
gux2Clustered GlcA substitutions, altered xylan domains
gux1/gux2Near-complete loss of GlcA/MeGlcA, collapsed xylem vessels

Experimental Uses

  • Enzymatic Assays: Recombinant GUX2 is used to study GlcA substitution kinetics and xylan backbone modification .

  • Antibody Development: Polyclonal antibodies against GUX2 enable detection via Western blotting and ELISA .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GUX2; PGSIP3; At4g33330/At4g33340; F17M5.90/F17M5.100; UDP-glucuronate:xylan alpha-glucuronosyltransferase 2; UDP-GlcA:xylan glucuronyltransferase 2; Glycogenin-like protein 2; Plant glycogenin-like starch initiation protein 3; Protein GLUCURONIC ACID SUBSTITUTION OF XYLAN 2; AtGUX2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-596
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
GUX2
Target Protein Sequence
MTIMTMIMKMAPSKSALIRFNLVLLGFSFLLYTAIFFHPSSSVYFSSGASFVGCSFRDCT PKVVRGVKMQELVEENEINKKDLLTASNQTKLEAPSFMEEILTRGLGKTKIGMVNMEECD LTNWKRYGETVHIHFERVSKLFKWQDLFPEWIDEEEETEVPTCPEIPMPDFESLEKLDLV VVKLPCNYPEEGWRREVLRLQVNLVAANLAAKKGKTDWRWKSKVLFWSKCQPMIEIFRCD DLEKREADWWLYRPEVVRLQQRLSLPVGSCNLALPLWAPQGVDKVYDLTKIEAETKRPKR EAYVTVLHSSESYVCGAITLAQSLLQTNTKRDLILLHDDSISITKLRALAAAGWKLRRII RIRNPLAEKDSYNEYNYSKFRLWQLTDYDKVIFIDADIIVLRNLDLLFHFPQMSATGNDV WIYNSGIMVIEPSNCTFTTIMSQRSEIVSYNGGDQGYLNEIFVWWHRLPRRVNFLKNFWS NTTKERNIKNNLFAAEPPQVYAVHYLGWKPWLCYRDYDCNYDVDEQLVYASDAAHVRWWK VHDSMDDALQKFCRLTKKRRTEINWERRKARLRGSTDYHWKINVTDPRRRRSYLIG
Uniprot No.

Target Background

Function
Recombinant Arabidopsis thaliana UDP-glucuronate:xylan alpha-glucuronosyltransferase 2 (GUX2) is a glycosyltransferase essential for adding both glucuronic acid and 4-O-methylglucuronic acid branches to xylan within stem cell walls. In conjunction with GUX1, it accounts for nearly all xylan backbone substitutions in stem glucuronoxylan.
Gene References Into Functions
  1. Research has identified two Golgi-localized glycosyltransferases, Glucuronic acid substitution of Xylan (GUX)-1 and GUX2, crucial for the addition of glucuronic acid and 4-O-methylglucuronic acid branches to xylan in Arabidopsis cell walls. [GUX2] PMID: 20852069
Database Links

KEGG: ath:AT4G33330

STRING: 3702.AT4G33330.2

UniGene: At.48931

Protein Families
Glycosyltransferase 8 family, Glycogenin subfamily
Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.

Q&A

What is Arabidopsis thaliana UDP-glucuronate:xylan alpha-glucuronosyltransferase 2 (GUX2)?

Arabidopsis thaliana UDP-glucuronate:xylan alpha-glucuronosyltransferase 2 (GUX2) is a member of Glycosyltransferase Family 8 that plays a critical role in plant cell wall biosynthesis. GUX2 functions specifically as a xylan α-glucuronosyltransferase, responsible for adding glucuronic acid (GlcA) and/or methylglucuronic acid (MeGlcA) substitutions onto the β(1,4)-linked xylose residue backbone of xylan . This enzyme is integral to secondary cell wall formation, where it creates distinct patterns of [Me]GlcA substitutions that differ from those produced by its paralogs GUX1 and GUX3 . The enzyme utilizes UDP-GlcA as a donor substrate to transfer GlcA moieties onto specific positions of the xylan backbone, contributing to cell wall structure and function in Arabidopsis.

How does GUX2 differ functionally from other GUX family members?

GUX2 exhibits distinct functional characteristics compared to other GUX family members, particularly in its pattern of glucuronic acid substitution on xylan. While both GUX1 and GUX2 are required for secondary wall biosynthesis and the substitution of the xylan backbone with [Me]GlcA, they create different distinct patterns of these substitutions . Research has shown that GUX1 strongly favors xylohexaose as an acceptor over shorter xylooligosaccharides, and with xylohexaose, it almost exclusively adds GlcA to the fifth xylose residue from the nonreducing end . In contrast, GUX2 demonstrates a different substitution pattern. GUX3 functions primarily in adding GlcA decorations to xylan in primary cell walls, unlike GUX1 and GUX2 which function in secondary cell walls . The combined action of these enzymes is crucial, as evident in the gux1/2/3 triple mutant which exhibits a complete loss of GlcA and MeGlcA side chains on xylan . This functional specialization among GUX family members demonstrates their non-redundant roles in xylan biosynthesis and cell wall formation.

What is the subcellular localization of GUX2 and why is it significant?

GUX2 is localized in the Golgi apparatus, which is consistent with its role in cell wall polysaccharide biosynthesis . This localization is significant for several reasons. First, the Golgi apparatus is the primary site for the synthesis and modification of cell wall polysaccharides in plants, including xylan. The presence of GUX2 in this organelle positions it strategically to participate in the xylan biosynthetic pathway. Second, this localization aligns with the characteristic features of Golgi-localized glycosyltransferases, supporting GUX2's biochemical function as a glucuronosyltransferase . The Golgi localization of GUX2, along with other GUX family members (GUX1, GUX3, GUX4, GUX5, and Plant Glycogenin-like Starch Initiation Protein6), indicates a common subcellular site for xylan modification . This shared localization facilitates the coordinated action of these enzymes in xylan biosynthesis, allowing for precise control over the pattern and degree of glucuronic acid substitution in plant cell walls.

What methodologies are effective for studying GUX2 enzymatic activity?

Studying GUX2 enzymatic activity requires a combination of biochemical, molecular, and analytical techniques. One effective approach involves heterologous expression of GUX2 followed by in vitro enzymatic assays. Researchers have successfully characterized GUX enzymes by expressing them in systems such as tobacco BY2 cells, which allows for the production of functional recombinant proteins . For in vitro activity assays, the purified enzyme is incubated with UDP-GlcA as the donor substrate and xylooligosaccharides of varying lengths as acceptor substrates. The reaction products can then be analyzed using techniques such as polysaccharide analysis by carbohydrate gel electrophoresis (PACE) after xylanase digestion .

For studying substrate specificity, researchers have determined that GUX enzymes show preferences for specific xylooligosaccharide lengths (with GUX1 favoring xylohexaose) and position-specific addition of GlcA (such as GUX1's preference for the fifth xylose residue from the nonreducing end) . Kinetic parameters, including Km values for UDP-GlcA (approximately 165 μM for GUX1), can be determined through standard enzyme kinetics approaches . These methodological approaches provide crucial insights into the biochemical mechanisms of GUX2 and its role in xylan biosynthesis.

How can researchers generate and characterize gux mutants?

Generation and characterization of gux mutants involves a systematic approach combining molecular genetics, biochemical analysis, and phenotypic characterization. To generate gux mutants, researchers typically utilize T-DNA insertion lines available through repositories like the Arabidopsis Biological Resource Center. Single mutants can be crossed to generate double (gux1/2) or triple (gux1/2/3) mutants for comprehensive functional analysis . Confirmation of the mutations is achieved through PCR-based genotyping using gene-specific and T-DNA border primers.

For characterization, researchers employ multiple complementary approaches:

  • Cell wall analysis: Extract alcohol-insoluble residues (AIR) from mutant plants and analyze xylan structure using enzymatic digestion followed by PACE or other chromatographic techniques .

  • Immunolabeling: Use xylan-specific antibodies to visualize changes in xylan distribution and abundance in cell walls.

  • Expression analysis: Confirm loss of gene expression through RT-PCR or RNA-seq.

  • Phenotypic assessment: Evaluate plant growth, development, and cell wall integrity in the mutants. This includes measuring parameters such as plant height, stem strength, and vascular development .

  • Complementation studies: Transform mutants with wild-type or modified GUX genes to confirm gene-phenotype relationships .

These approaches collectively provide a comprehensive understanding of GUX function through loss-of-function analysis.

What analytical techniques are most effective for characterizing xylan glucuronidation patterns?

Characterizing xylan glucuronidation patterns requires sophisticated analytical techniques that can provide detailed structural information. Several complementary approaches have proven effective in this area:

  • Polysaccharide Analysis by Carbohydrate Gel Electrophoresis (PACE): This technique involves enzymatic digestion of xylan using specific xylanases (typically GH11 xylanase), followed by fluorescent labeling of the released oligosaccharides and separation by gel electrophoresis. PACE provides information about the relative abundance of different glucuronidated xylooligosaccharides, enabling detection of specific patterns like XUXX and XUUXX oligosaccharides (where X represents xylose and U represents glucuronic acid) .

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: NMR provides detailed information about the chemical structure and substitution patterns of xylan, allowing researchers to determine the precise positions of GlcA substitutions along the xylan backbone.

  • Mass Spectrometry (MS): Techniques such as MALDI-TOF-MS or LC-MS/MS can be used to analyze the mass and fragmentation patterns of xylooligosaccharides, providing information about the degree and pattern of substitution.

  • High-Performance Anion-Exchange Chromatography with Pulsed Amperometric Detection (HPAEC-PAD): This technique separates oligosaccharides based on their charge and can be used to quantify the relative abundance of different glucuronidated xylooligosaccharides.

These analytical approaches have revealed that different GUX enzymes create distinct patterns of glucuronidation, with GUX1 and GUX2 in Arabidopsis producing different distributions of [Me]GlcA substitutions on the xylan backbone .

How do researchers reconcile contradictory findings regarding phenotypes in gux mutants?

Reconciling contradictory findings in gux mutant phenotypes requires careful consideration of experimental conditions, genetic backgrounds, and methodological approaches. A notable contradiction exists in the literature regarding the phenotype of the gux1/2/3 triple mutant. One study reported that the triple mutant exhibited reduced secondary wall thickening, collapsed vessel morphology, and inhibited plant growth . In contrast, another thorough investigation found that the absence of GlcA on xylan had no impact on plant growth in the same triple mutant .

To reconcile such contradictions, researchers should implement several strategies:

  • Standardized growth conditions: Ensuring identical growth conditions (light, temperature, humidity, soil composition) across experiments to minimize environmental variables.

  • Genetic background verification: Confirming the genetic background of mutant lines through whole-genome sequencing or extensive marker analysis to identify potential background mutations.

  • Quantitative phenotyping: Employing quantitative measurements rather than qualitative observations for phenotypic characterization, including statistical analysis of multiple biological replicates.

  • Temporal analysis: Assessing phenotypes at multiple developmental stages to identify potential stage-specific effects that might be missed in single time-point analyses.

  • Cell-type specific analysis: Examining effects in specific cell types rather than whole tissues, as compensatory mechanisms might mask phenotypes at the whole-plant level.

  • Multi-laboratory validation: Conducting identical experiments in different laboratories to verify reproducibility and identify potential laboratory-specific variables.

This systematic approach enables researchers to determine whether contradictions arise from genuine biological variability or from differences in experimental approaches .

How does heterologous expression of conifer GUX genes inform our understanding of xylan biosynthesis evolution?

Heterologous expression of conifer GUX genes in model systems like Arabidopsis provides valuable insights into the evolutionary conservation and diversification of xylan biosynthesis mechanisms. Research involving the expression of conifer GUX enzymes, such as PtGUX2 from pine species, in gux1/2/3 Arabidopsis mutants has revealed several important findings :

  • Functional conservation: Conifer GUX enzymes are capable of glucuronidating xylan in planta when expressed in Arabidopsis, demonstrating the conservation of basic enzymatic function across evolutionarily distant plant lineages. This suggests that the core mechanism of xylan glucuronidation emerged early in land plant evolution and has been maintained across divergent lineages .

  • Pattern specificity: The patterns of GlcA substitution introduced by conifer GUX enzymes differ from those of native Arabidopsis enzymes. For example, PtGUX2 expression in gux1/2/3 Arabidopsis resulted in the detection of specific oligosaccharides (XUXX and XUUXX) after GH11 digestion, indicating a distinct pattern of glucuronidation .

  • Functional implications: Despite differences in substitution patterns, conifer GUX-mediated glucuronidation can rescue certain phenotypes in Arabidopsis mutants. The GlcA pattern introduced by PtGUX2 was able to confer biomass recalcitrance in the Arabidopsis model, reducing the release of both glucose and xylose to levels similar to wild-type plants during saccharification assays .

These findings suggest that while the basic enzymatic function of GUX enzymes is conserved across plant lineages, the specific patterns of glucuronidation may have diverged to meet the specialized requirements of different plant groups, particularly in relation to secondary cell wall structure and function.

What factors influence GUX2 gene expression in different plant tissues and under various conditions?

GUX2 gene expression is regulated by a complex interplay of developmental, tissue-specific, and environmental factors. Understanding these regulatory mechanisms provides insights into how plants modulate cell wall composition in response to different conditions. Based on transcriptome analyses of related GUX genes, several key factors influence GUX2 expression:

  • Tissue-specific regulation: GUX gene expression varies significantly across different plant tissues. Analysis of expression patterns in species like Eucalyptus grandis has revealed distinct expression profiles of GUX genes in roots, leaves, xylem, phloem, and different internodes of branches . This tissue-specific expression correlates with the varying requirements for xylan biosynthesis and modification in different plant tissues.

  • Developmental stage: GUX gene expression changes throughout plant development, with expression patterns differing between young and mature tissues. For example, expression analysis in 6-month-old versus 6-year-old tissues reveals developmental regulation of GUX genes .

  • Hormonal signaling: Plant hormones such as salicylic acid (SA) and methyl jasmonate (MeJA) can modulate GUX gene expression. Differential expression analysis of leaves treated with these hormones for varying durations (0, 1, 6, 24, and 168 hours) demonstrates their regulatory influence on GUX genes .

  • Stress responses: Environmental stresses, particularly salt stress, can alter GUX gene expression patterns, suggesting a role for xylan modification in stress adaptation .

  • Transcription factors: Secondary wall-associated transcription factors, particularly members of the NAC and MYB families, likely regulate GUX2 expression as part of the broader secondary cell wall biosynthetic program.

Understanding these regulatory mechanisms provides insights into how plants control xylan biosynthesis and modification in response to developmental and environmental cues, with implications for cell wall engineering and crop improvement strategies.

How does GUX2 activity impact biomass recalcitrance and potential biofuel applications?

GUX2 activity significantly influences biomass recalcitrance - the resistance of plant material to enzymatic breakdown - which has direct implications for biofuel production. Research has demonstrated a clear relationship between xylan glucuronidation patterns and biomass digestibility:

  • Reduced recalcitrance in gux mutants: The gux1/2/3 Arabidopsis mutant, which lacks [Me]GlcA branches on xylan, shows significantly reduced biomass recalcitrance to enzymatic digestion . This indicates that glucuronic acid substitutions on xylan contribute substantially to the resistance of plant biomass to enzymatic breakdown.

  • Pattern-specific effects: The specific pattern of glucuronidation, rather than merely the presence of GlcA residues, appears crucial for determining recalcitrance. When PtGUX2 (a conifer GUX enzyme) was expressed in gux1/2/3 Arabidopsis, it restored the wild-type level of recalcitrance despite introducing a different pattern of GlcA substitutions . This suggests that different GUX enzymes may create distinct "locking" patterns that influence how tightly xylan interacts with other cell wall components.

  • Quantifiable impact on sugar release: Saccharification assays have shown that GUX activity affects the release of both glucose and xylose from plant biomass. In the gux1/2/3 plants expressing PtGUX2, the release of both glucose and xylose was reduced to levels measured for wild-type Arabidopsis .

These findings have significant implications for biofuel production and biomass utilization:

  • Engineering reduced recalcitrance: Modifying GUX expression or activity could be a strategy to engineer plants with reduced biomass recalcitrance, potentially increasing the efficiency and reducing the cost of biofuel production.

  • Balancing recalcitrance and plant fitness: Complete elimination of GUX activity might reduce plant fitness or structural integrity in some species, so optimal engineering strategies may involve modifying rather than eliminating glucuronidation patterns.

  • Species-specific optimization: The distinct patterns of glucuronidation created by GUX enzymes from different plant species might be exploited to optimize biomass properties for specific applications.

The relationship between GUX2 activity and biomass recalcitrance represents a promising target for biotechnological applications aimed at improving the efficiency of biomass conversion processes.

Comparison of GUX Family Members and Their Functions

GUX Family MemberPrimary FunctionTissue LocalizationSubstrate PreferencePattern of GlucuronidationImpact of Mutation
GUX1Secondary wall xylan glucuronidationSecondary cell wallsStrongly favors xylohexaoseAlmost exclusively adds GlcA to fifth xylose from nonreducing endReduced [Me]GlcA content in secondary wall xylan
GUX2Secondary wall xylan glucuronidationSecondary cell wallsLess specific length requirementsCreates distinct pattern from GUX1Reduced [Me]GlcA content in secondary wall xylan
GUX3Primary wall xylan glucuronidationPrimary cell wallsNot fully characterizedCreates primary wall-specific patternAffects primary wall xylan structure
GUX4Has xylan α-glucuronosyltransferase activityGolgi apparatusNot fully characterizedNot fully characterizedNot fully characterized
GUX5Not confirmed to have activityGolgi apparatusNot detectedNot detectedNot fully characterized

The distinct functions and properties of GUX family members highlight their non-redundant roles in plant cell wall biosynthesis . While GUX1 and GUX2 both function in secondary cell walls and GUX3 in primary cell walls, they create different patterns of glucuronidation that likely contribute to specialized cell wall properties. The tissue-specific expression and distinct substrate preferences of these enzymes provide insights into the complex regulation of xylan structure in different plant tissues and developmental stages.

Methodological Approaches for Studying GUX2 Function

ApproachDescriptionAdvantagesLimitationsKey Applications
Heterologous ExpressionExpression of GUX2 in systems like tobacco BY2 cells or Arabidopsis mutantsAllows functional characterization in controlled systemsMay not fully recapitulate native conditionsDetermining enzyme activity and substrate specificity
In vitro Enzymatic AssaysIncubation of purified enzyme with UDP-GlcA and xylooligosaccharidesPrecise control of reaction conditionsMay not reflect in vivo complexityDetermining kinetic parameters and substrate preferences
PACE AnalysisEnzymatic digestion followed by fluorescent labeling and gel electrophoresisHigh sensitivity for detecting specific oligosaccharidesLimited to detecting patterns visible after specific enzymatic digestionCharacterizing glucuronidation patterns
Mutant PhenotypingAnalysis of gux single, double, and triple mutantsReveals in vivo functionPotential for genetic redundancy or compensationUnderstanding physiological roles
Complementation StudiesExpression of GUX2 in gux mutantsConfirms gene-phenotype relationshipsMay be affected by expression level differencesValidating gene function
Saccharification AssaysMeasuring sugar release from biomassDirectly assesses impact on biomass recalcitranceMay be influenced by multiple factors beyond glucuronidationEvaluating potential for biofuel applications

These methodological approaches provide complementary insights into GUX2 function, from biochemical mechanisms to physiological roles and potential applications . Integration of multiple approaches is essential for comprehensive understanding of GUX2 biology.

Evolutionary Conservation of GUX Enzymes Across Plant Species

Plant SpeciesGUX RepresentativesKey FindingsImplications for EvolutionReference
Arabidopsis thalianaGUX1, GUX2, GUX3, GUX4, GUX5Different GUX members create distinct patterns of glucuronidationFunctional specialization within species
Pinus radiata (Pine)PrGUX1, PrGUX2Expression profiling shows tissue-specific patternsConservation of tissue-specific regulation
Pinus taeda (Loblolly pine)PtGUX2Can complement Arabidopsis gux mutants and restore recalcitranceFunctional conservation across gymnosperms and angiosperms
Eucalyptus grandisEgGUX family membersExpression varies across tissues and developmental stagesConserved regulatory mechanisms in woody angiosperms

This evolutionary comparison reveals that while the basic enzymatic function of GUX enzymes is conserved across diverse plant lineages, there has been evolutionary diversification in terms of family size, expression patterns, and specific glucuronidation activities . The ability of conifer GUX enzymes to function in angiosperms suggests that the core enzymatic mechanism emerged early in land plant evolution and has been maintained across plant lineages, while patterns of expression and regulation have diversified to meet the specific needs of different plant groups.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.