Recombinant Arabidopsis thaliana Uncharacterized ATP synthase C chain-like protein (AtMg00040)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Please contact us in advance; additional fees apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
AtMg00040; Uncharacterized ATP synthase C chain-like protein; ORF315
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-315
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
AtMg00040
Target Protein Sequence
MTKREYNSQPEMLEGAKSIGAGAATIASAGAAIGIGNVFSSLIHSVARNPSLATTTVLVV TLTLLGGVAAFYLHSFRLKGPLKKIIYLFLVFFIAVGISLIRIKAIHLLGLALPLLVPPL VWNAIGGGGEALPSTGPNGASSYSEWFTYTSDLEDSASSGRTSSSVNQPIQREQAGPSNA LPEPAASPVAQQQDHLDQPFGEGGEREARAQEHDRISAEVETITSACENLEAAMVRKAHI LLHQRGVTLGDPEDVKRALQLALHDDWEHDIDDRKRHFTVLRRDFGTARCERWNPFIDEL RGLGNRQVNARHYVD
Uniprot No.

Target Background

Database Links
Protein Families
ATPase C chain family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What cloning strategies are most effective for recombinant expression of uncharacterized ATP synthase proteins from Arabidopsis thaliana?

For efficient cloning and expression of uncharacterized ATP synthase proteins like AtMg00040, researchers should consider expressing truncated versions containing the catalytic domain rather than the full-length protein. This approach has proven successful with other Arabidopsis proteins, such as the truncated AtAC261-388 fragment that retained adenylyl cyclase activity. For expression, the pET-28a vector system with N-terminal His-tag fusion is recommended to facilitate subsequent affinity purification. E. coli BL21(DE3) remains the preferred expression host, with induction using 0.5-1.0 mM IPTG at 18-22°C for 16-18 hours to minimize inclusion body formation .

How should researchers optimize the purification protocol for recombinant ATP synthase proteins from Arabidopsis thaliana?

Purification of recombinant ATP synthase proteins requires careful optimization to preserve structural integrity and enzymatic activity. Based on successful approaches with similar proteins, a recommended protocol includes:

  • Cell lysis using sonication in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, and protease inhibitors

  • Initial purification using Ni-NTA affinity chromatography with imidazole gradient elution (20-250 mM)

  • Secondary purification via size exclusion chromatography using Superdex 200 column

  • Buffer optimization containing stabilizing agents like glycerol (10-15%) and reducing agents (1-5 mM DTT)

This approach yielded highly purified recombinant AtAC261-388 protein that maintained enzymatic activity, as verified by SDS-PAGE analysis, and could be adapted for ATP synthase proteins .

What expression systems provide optimal yields for functional recombinant ATP synthase proteins from Arabidopsis?

While E. coli remains the workhorse for initial characterization studies, plant-based expression systems may offer advantages for obtaining properly folded and post-translationally modified ATP synthase proteins. For AtMg00040 and similar proteins, researchers should consider:

  • E. coli expression: BL21(DE3) or Rosetta strains with cold-induction protocols (18°C) to enhance solubility

  • Transient expression in Nicotiana benthamiana via Agrobacterium-mediated transformation

  • Stable expression in Arabidopsis cell suspension cultures

Each system presents tradeoffs between yield, post-translational modifications, and functional activity. For example, the AtAC261-388 recombinant protein was successfully produced in E. coli with yields of approximately 1-2 mg/L culture, sufficient for initial biochemical characterization .

How can researchers determine if an uncharacterized ATP synthase protein exhibits tissue-specific expression patterns similar to ATPC1 and ATPC2?

To investigate tissue-specific expression patterns of AtMg00040 or similar uncharacterized ATP synthase proteins, researchers should implement a multi-faceted approach:

  • Transcriptome analysis: Mining publicly available RNA-seq datasets across different Arabidopsis tissues and developmental stages

  • Promoter-reporter fusion constructs: Generating transgenic plants with the AtMg00040 promoter fused to GUS or fluorescent protein reporters

  • Tissue-specific qRT-PCR: Performing quantitative expression analysis across roots, leaves, flowers, and seeds

This approach revealed that ATPC2 is predominantly expressed in Arabidopsis roots, while ATPC1 shows higher expression in photosynthetic tissues, indicating functional specialization. Similar analysis for AtMg00040 would provide insights into potential tissue-specific roles .

What methodological approaches can distinguish between redox-regulated and non-redox-regulated ATP synthase proteins in Arabidopsis?

Determining the redox regulation status of ATP synthase proteins requires targeted experimental approaches:

  • In situ redox titrations: Subject purified recombinant protein to controlled redox environments (DTT for reducing conditions, diamide for oxidizing conditions) while measuring activity

  • Site-directed mutagenesis: Modify putative regulatory cysteine residues and assess impact on activity

  • Comparative activity assays: Measure enzyme activity in light versus dark conditions in chloroplast preparations

Research on ATPC1 and ATPC2 demonstrates how these approaches revealed fundamental differences in regulation - γ1-containing ATP synthase (ATPC1) shows classic light-induced redox regulation, while γ2-containing ATP synthase (ATPC2) maintains high activity in both light and dark conditions. The regulatory difference was attributed to alterations in residues near redox-active thiols, which can be identified through sequence alignment and structural analysis .

How can researchers determine the subcellular localization and assembly of uncharacterized ATP synthase proteins?

For definitive subcellular localization and assembly analysis of ATP synthase proteins like AtMg00040, researchers should implement:

  • Fluorescent protein fusion constructs with confocal microscopy

  • Subcellular fractionation followed by Western blot analysis

  • Immunogold electron microscopy for precise localization

  • Blue native PAGE to analyze intact complexes and subcomplex assembly

Understanding subcellular localization is critical as ATP synthase complexes function in both mitochondria and chloroplasts. Research on ATPC1 and ATPC2 demonstrated that while both proteins can support photosynthetic ATP synthesis with similar specific activities, only γ1 (ATPC1) participates in ATP synthesis during photosynthesis in wild-type plants. Similar methodological approaches could reveal whether AtMg00040 assembles into functional complexes and in which cellular compartments .

What analytical methods can determine if uncharacterized ATP synthase proteins like AtMg00040 function in novel signaling pathways?

To investigate potential roles of AtMg00040 in signaling pathways:

  • Metabolomic profiling: Compare wild-type and knockout/overexpression lines using LC-MS/MS to identify altered metabolites

  • Protein-protein interaction studies: Employ yeast two-hybrid, co-immunoprecipitation, or proximity labeling approaches

  • Calcium flux measurements: Monitor Ca²⁺ signaling in response to altered protein expression

  • Stress response assays: Assess phenotypic responses to various stressors in genetic modification lines

This approach is informed by research on other Arabidopsis proteins with cyclase activity that participate in signaling pathways. For example, AtAC demonstrated manganese-dependent adenylyl cyclase activity that generates cAMP from ATP and is enhanced by calcium and hydrogen carbonate, suggesting integration with calcium signaling pathways .

What techniques are most effective for assessing enzymatic activity of recombinant ATP synthase proteins?

For rigorous enzymatic characterization of recombinant ATP synthase proteins like AtMg00040, researchers should employ complementary activity assays:

  • Enzyme immunoassay: Quantify ATP/cAMP levels using commercially available ELISA kits

  • Tandem liquid chromatography-mass spectrometry (LC-MS/MS): Provide sensitive detection of reaction products at femtomolar concentrations

  • Coupled enzyme assays: Measure ATP synthesis/hydrolysis via linked reactions with luciferase or pyruvate kinase/lactate dehydrogenase

  • Proton flux measurements: Monitor proton translocation across membranes using pH-sensitive dyes

These approaches provided complementary confirmation of the adenylyl cyclase activity of recombinant AtAC261-388, demonstrating manganese-dependent activity enhanced by calcium and hydrogen carbonate. Similar methodological rigor should be applied to characterizing potential ATP synthase activity of AtMg00040 .

How should researchers design loss-of-function and gain-of-function studies for uncharacterized ATP synthase proteins?

To establish the biological function of AtMg00040 and similar proteins, researchers should implement:

  • CRISPR/Cas9-mediated gene editing: Generate precise knockout or knockdown lines

  • Tissue-specific and inducible expression systems: Control protein expression temporally and spatially

  • Complementation studies: Express the protein in mutant backgrounds to verify functional restoration

  • Heterologous expression: Test function in different genetic backgrounds or species

This approach was effective in characterizing the γ2-ATP synthase (ATPC2), revealing that its expression is linked to root hair development, consistent with its predominant expression in root tissues. Analysis of phenotypic changes in roots, development, and stress responses can provide insights into the biological role of uncharacterized ATP synthase proteins .

What crystallization methods are most promising for structural determination of Arabidopsis ATP synthase proteins?

For structural characterization of ATP synthase proteins like AtMg00040, researchers should consider:

  • Sitting drop vapor diffusion method: This technique successfully produced crystals of recombinant Arabidopsis threonine synthase that diffracted to beyond 0.28 nm resolution

  • Optimization of crystallization conditions: Screen buffers with pH range 6.5-8.5, precipitants including PEG 3350-8000, and additives such as divalent cations

  • Co-crystallization with substrate analogs or regulatory molecules to capture different conformational states

  • Cryo-electron microscopy as an alternative approach for challenging proteins resistant to crystallization

Understanding the structural features of ATP synthase proteins provides critical insights into their functional mechanisms, regulatory properties, and potential for structure-based drug design. Previous crystallization of Arabidopsis proteins achieved high-resolution diffraction belonging to space group P222 with unit cell parameters: a = 6.16 nm, b = 10.54 nm, c = 14.63 nm, α = β = γ = 90° .

How can researchers predict and validate the quaternary structure of uncharacterized ATP synthase proteins?

To determine the quaternary structure of AtMg00040 and similar proteins:

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS): Measure absolute molecular weight in solution

  • Analytical ultracentrifugation: Determine sedimentation coefficient and shape parameters

  • Chemical crosslinking coupled with mass spectrometry: Identify subunit interfaces

  • Homology modeling with quaternary structure prediction tools like SWISS-MODEL and AlphaFold-Multimer

Research on Arabidopsis threonine synthase revealed it exists as a dimer, while its counterparts from E. coli and yeast function as monomers. This structural difference correlates with functional differences, as the plant enzyme exhibits unique regulatory properties including 85-fold activation by S-adenosyl-L-methionine. Similar structure-function relationships may exist for AtMg00040 .

What integrated approaches should researchers employ to fully characterize the function of AtMg00040?

A comprehensive characterization of AtMg00040 requires integration of multiple experimental approaches:

  • Bioinformatic analysis: Phylogenetic classification, domain prediction, and sequence conservation analysis across species

  • Biochemical characterization: Recombinant expression, purification, and enzymatic activity assays

  • Structural studies: Crystallization or cryo-EM structure determination

  • In vivo functional analysis: Generation of mutant/transgenic lines and phenotypic characterization

  • Systems biology: Integration with transcriptomics, proteomics, and metabolomics data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.