Recombinant Arabidopsis thaliana Uncharacterized calcium-binding protein At1g02270 (At1g02270)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with blue ice packs unless dry ice shipping is specifically requested and arranged in advance (additional fees apply).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us; we will prioritize its inclusion.
Synonyms
At1g02270; T6A9_9; T7I23.22; Uncharacterized calcium-binding protein At1g02270
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-484
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At1g02270
Target Protein Sequence
MQSHQNRSRLSLILRSRFIPSFSSPLSLFVVLAAVPLPIYFSGLLSGRNNKPLSVMRLNS NLASSMVESNISCTTFNILAPIYKRVDQKNHSTRESDFRTLWLARNQRILDLLLHQRSSV ICLQEVWVGNEELVNMYHHQLSSSGYTIYQLARTNSRGDGLLTAIHKDHFKVVNYRELLF NDFGDRVAQLLHVKTVIPFPLNGKQDVQQEVIIVNTHLLFPHDSSLSIVRLHQVYKILEY LEAYQKENKLNHMPIILCGDWNGSKRGHVYKFLRSQGFISSYDDAHQYTDSDAHRWVSHR NHRGNICGVDFIWLCNPSDSRKPLRTSWVEAVFSIIKYQLHKASIAEDDAFTFLGAKNHS DSLTYSDFCLALQKVNLTGIPHGLSFEETKELWVRADLDGNGVFDYEELKKIWNMTMVNQ PGNCKESVMESKKEEGEDEAIGLKVNKAILFPQEAEKGLWPENYNISDHACLTVQFSPVK MLCS
Uniprot No.

Target Background

Database Links

KEGG: ath:AT1G02270

STRING: 3702.AT1G02270.1

UniGene: At.10716

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is At1g02270 and what are its basic structural characteristics?

At1g02270 is an uncharacterized calcium-binding protein from Arabidopsis thaliana with a full length of 484 amino acids. It is classified as a calcium-binding protein based on sequence analysis and predicted structural motifs. The protein is available as a recombinant product expressed in E. coli systems with an N-terminal histidine tag to facilitate purification and downstream applications . The protein likely contains calcium-binding domains that enable it to interact with calcium ions, potentially playing regulatory roles in calcium-dependent signaling pathways in plants, although its specific functions remain largely uncharacterized. As with other calcium-binding proteins, its structure-function relationships are determined by the coordination chemistry of calcium within specific binding motifs.

What expression systems are most effective for producing recombinant At1g02270 protein?

E. coli-based expression systems have been successfully employed for the recombinant production of At1g02270 with a histidine tag. The optimization of expression conditions follows general principles of recombinant protein production, which typically involves:

  • Vector selection with appropriate promoters (T7, tac, etc.)

  • Host strain optimization (BL21(DE3), Rosetta, etc.)

  • Induction parameters optimization (IPTG concentration, temperature, duration)

  • Media composition adjustment

Rather than using the inefficient one-factor-at-a-time approach, researchers should consider implementing Design of Experiments (DoE) methodologies to optimize expression conditions. DoE approaches enable the systematic evaluation of multiple factors simultaneously, providing insights into factor interactions that affect protein yield and quality with fewer experiments . For At1g02270 specifically, lower induction temperatures (16-25°C) may be beneficial to enhance protein solubility, as is common with many calcium-binding proteins.

How can I verify the calcium-binding capability of recombinant At1g02270?

Several complementary approaches can be employed to verify and characterize calcium binding:

TechniquePurposeExperimental SetupData Interpretation
Isothermal Titration Calorimetry (ITC)Binding affinity measurementTitration of calcium into protein solutionProvides Kd, stoichiometry, ΔH, ΔS
Circular Dichroism (CD)Conformational changesSpectra with and without calciumChanges indicate calcium-induced structural shifts
Tryptophan FluorescenceLocal structural changesEmission spectra ±Ca²⁺Shifts indicate altered tryptophan environment
⁴⁵Ca²⁺ Overlay AssayQualitative bindingProtein on membrane exposed to radioactive calciumPositive signal confirms binding
Calcium-induced Mobility ShiftConformational changesNative PAGE ±Ca²⁺Migration differences indicate binding

When analyzing calcium-binding properties, researchers should consider multiple metal ion controls (Mg²⁺, Mn²⁺, Zn²⁺) to assess specificity, and evaluate binding under various pH and ionic strength conditions to understand physiological relevance .

What approaches can be used to deduce the physiological function of At1g02270?

Since At1g02270 remains uncharacterized, multiple complementary approaches should be employed to elucidate its function:

  • Protein Interaction Studies:

    • Yeast two-hybrid screening

    • Co-immunoprecipitation followed by mass spectrometry

    • Protein microarrays with Arabidopsis proteome

  • Gene Expression Analysis:

    • RNA-seq under various calcium stress conditions

    • Tissue-specific expression profiling

    • Co-expression network analysis with known calcium signaling components

  • Genetic Approaches:

    • T-DNA insertion mutants or CRISPR-generated knockouts

    • Overexpression lines

    • Complementation assays

    • Phenotypic analysis under various calcium stress conditions

  • Subcellular Localization:

    • GFP fusion protein expression

    • Immunolocalization with specific antibodies

    • Cell fractionation and Western blot analysis

A comprehensive analysis would integrate these approaches to build a functional model of At1g02270's role in calcium signaling networks within Arabidopsis.

How can I design calcium sensors based on At1g02270 structure?

The design of calcium sensors based on At1g02270 would involve several strategic steps:

  • First, thoroughly characterize the calcium binding sites within At1g02270 using computational prediction algorithms and experimental validation.

  • Identify the key determinants for calcium binding affinity, cooperativity, and calcium-dependent conformational changes within the protein structure.

  • Incorporate fluorescent reporter systems:

    • FRET pairs (e.g., CFP/YFP) flanking the calcium-binding domain

    • Single fluorophore insertion at strategic locations near calcium-binding sites

    • Fusion with circularly permuted fluorescent proteins that respond to conformational changes

  • Optimize the sensor through iterative design:

    • Adjust linker lengths between domains

    • Introduce mutations to fine-tune calcium affinity

    • Test in various cellular compartments

The complexity in designing effective calcium sensors stems from the diverse coordination chemistry of calcium and challenges related to protein folding and binding cooperativity. Statistical analysis of existing calcium-binding sites in proteins can inform prediction algorithms for identifying optimal locations for sensor development .

What is known about the genomic context and polymorphism patterns of At1g02270 in Arabidopsis populations?

Genome-wide studies in Arabidopsis thaliana reveal complex patterns of polymorphism that provide context for understanding At1g02270 variation. A. thaliana exhibits substantial population structure, with approximately 33% of genetic variation occurring among individuals within populations, 35% among local populations within regions, and 26% among broader geographical regions .

For genes like At1g02270, researchers should examine:

  • Allelic diversity across global accessions, particularly evaluating if the calcium-binding domains show conservation or diversification

  • Selection patterns using metrics like Tajima's D, which can identify regions under purifying or balancing selection

  • Linkage disequilibrium patterns around At1g02270, noting that LD typically decays within 25-50 kb in Arabidopsis

  • Population structure effects on At1g02270 variants, considering that genetic exchange in Arabidopsis occurs both geographically and through occasional outcrossing

How can I effectively map At1g02270 function in the triplicated Arabidopsis genome?

Mapping gene function in Arabidopsis is complicated by genome triplication events. For At1g02270, researchers should:

  • Identify potential paralogs resulting from duplication events using synteny analysis and sequence comparison.

  • Consider the collinearity with Arabidopsis chromosomes, noting that BAC clone mapping has revealed complex relationships where fragments may map to multiple chromosomal locations (as observed in other regions where BACs mapped to two different regions on chromosome C8 and one region on chromosome C5) .

  • Employ a hierarchical mapping approach:

    • Begin with BAC library screening using overgo probes specific to At1g02270

    • Perform fingerprinting analysis to group overlapping clones

    • Confirm the putative contig assembly through end-sequencing

    • Verify collinearity with reference genome sequences

    • Map genetically using appropriate markers

  • When designing functional studies, consider potential functional redundancy with paralogs, which may necessitate multiple gene knockouts to observe phenotypes.

Research shows that in Brassica species (related to Arabidopsis), genomic blocks often exist in triplicate, with sequence similarities to Arabidopsis chromosome regions distributed across multiple chromosomes .

How can I optimize purification protocols for recombinant At1g02270 using Design of Experiments (DoE) approaches?

The purification of recombinant proteins like At1g02270 involves multiple interdependent variables. Rather than traditional one-factor-at-a-time optimization, DoE approaches provide more efficient and comprehensive optimization:

  • Factor identification: For His-tagged At1g02270 purification, critical factors include:

    • Imidazole concentration in binding, washing, and elution buffers

    • pH of buffers

    • Flow rate

    • Calcium concentration (which may affect protein conformation and binding)

    • Salt concentration

  • DoE implementation:

    • Begin with a screening design (fractional factorial) to identify significant factors

    • Follow with response surface methodology (RSM) to optimize critical factors

    • Use Central Composite Design or Box-Behnken Design for efficient experimentation

  • Analysis and optimization:

    • Use appropriate software packages to analyze results and identify optimal conditions

    • Validate the predicted optimal conditions experimentally

    • Develop a robust purification protocol based on validated conditions

This approach significantly reduces experimental costs and time compared to traditional methods while accounting for interaction effects between purification parameters . For calcium-binding proteins like At1g02270, special consideration should be given to buffer conditions that may affect calcium binding and protein stability.

What are the best approaches for resolving the three-dimensional structure of At1g02270?

Determining the structure of At1g02270 requires strategic application of complementary methods:

MethodAdvantagesChallengesResolutionSample Requirements
X-ray CrystallographyHighest resolution; complete structureRequires crystallization0.5-3.0 Å5-10 mg purified protein; crystals
NMR SpectroscopySolution structure; dynamics informationSize limitation (~30 kDa domains)2-5 Å5-15 mg isotope-labeled protein
Cryo-EMWorks with larger complexes; no crystals neededLower resolution for small proteins2.5-4 Å0.1-1 mg purified protein
Small-Angle X-ray ScatteringWorks in solution; low sample requirementsLow resolution; shape only10-20 Å1-2 mg purified protein
AlphaFold2 PredictionNo experimental samples needed; fastAccuracy varies with template availabilityVariesSequence only

For calcium-binding proteins like At1g02270 (484 amino acids) , researchers should consider:

  • Domain-based approaches, potentially expressing individual domains separately for NMR studies

  • Structure determination both with and without calcium to capture conformational changes

  • Molecular dynamics simulations to understand calcium-induced dynamics

  • Integration of low-resolution experimental data with computational models

The inclusion of calcium or calcium analogs (e.g., lanthanides) during crystallization may stabilize the protein structure and provide insights into metal coordination geometry.

How can contradictory findings about At1g02270 function be reconciled through experimental design?

When faced with contradictory findings regarding At1g02270 function, systematic experimental approaches can help resolve discrepancies:

  • Standardize experimental conditions:

    • Ensure consistent protein preparations (tag position, purification methods)

    • Control calcium concentrations precisely using calibrated buffers

    • Standardize assay conditions (temperature, pH, ionic strength)

  • Employ orthogonal methods:

    • Validate calcium binding through multiple independent techniques

    • Confirm protein-protein interactions with at least three different methods

    • Verify subcellular localization using both fluorescent tagging and fractionation

  • Context-dependent analysis:

    • Test function under various physiological conditions

    • Examine developmental stage-specific effects

    • Consider tissue-specific expression patterns

  • Integrated data analysis:

    • Use meta-analysis approaches to identify sources of variability

    • Employ Bayesian frameworks to integrate conflicting data

    • Develop predictive models that account for context-dependent functions

  • Collaborative validation:

    • Establish inter-laboratory validation studies

    • Share standardized protocols and reagents

    • Develop community standards for functional assays

When publishing results, explicitly address methodological differences that might explain contradictory findings, and propose unified models that accommodate seemingly disparate observations.

What are the most promising future research directions for At1g02270?

Based on current knowledge about calcium-binding proteins and the Arabidopsis genome, several promising research directions emerge:

  • Systems biology integration - Positioning At1g02270 within calcium signaling networks through interactome mapping and multi-omics approaches

  • Stress response characterization - Investigating the role of At1g02270 in calcium-mediated responses to abiotic and biotic stresses

  • Structural biology - Resolving the three-dimensional structure to identify unique features of calcium coordination and conformational dynamics

  • Comparative genomics - Analyzing orthologous proteins across plant species to understand evolutionary conservation and divergence of function

  • Synthetic biology applications - Developing At1g02270-derived calcium sensors or switches for biotechnological applications

  • Crop improvement potential - Exploring whether modulation of At1g02270 orthologs in crop species affects stress tolerance or developmental traits

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.