Recombinant Arabidopsis thaliana Uncharacterized membrane protein At1g75140 (At1g75140)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to sediment the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
At1g75140; 22H5.14; Uncharacterized membrane protein At1g75140
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-617
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At1g75140
Target Protein Sequence
MADSQNGKSAFFFFFVSLILLFLSPSYSDVTASESDPIPYENSDASPGVVTSSESDRQGV SLHRLEELVRNLTELVARLDAKLSETPFKVKKEITRDEIEEKAKAFSVTKYSPFWSERFE FTSAVKLDSEATCINVLPFRDHEGLSKYFAVGDSSGRVFVFLRNGDVLVEFFTTCDSPIT AMVSYMSVYKNESFVVTGHQSGVILLHRLREGSIGEDLNSAVMENVGKFDGTEDGLQVTL LEVHHVGRVRYILATDLSGKLTVFTENRTVYGSVSPTSRPLVFLKQRLLFLTETGAGSLD LRSMKIRESECEGLNHSLARSYVFDASERAKAYGFTSEGEIIHVLLLGDIMNFKCRVRSK KKVQMEEPVALQAIKGYLLIVNQEKVFVYNVSTQHYVRTTGPRLLFPAALEDIRSTFLSH RESTKTTDHQKLEKVTPLIASDREKLLVMGLGDGYVATYKSKLPISKAEFNTMLWSSPVF FFILFLFGAWHFFSKKKESLTAWGPDDPFSSTTMSSSSTTTAQNSSAFSESTRRNDDHMD LRRRYVSPSRYPPGAATGAYRSVGSNDPSSRAPVETTNYRTTAQEMKYRGGSGLDSGGFG KRRESLFGNNKALDDES
Uniprot No.

Target Background

Database Links

KEGG: ath:AT1G75140

STRING: 3702.AT1G75140.1

UniGene: At.27644

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is At1g75140 and why is it of interest to researchers?

At1g75140 is an uncharacterized membrane protein from the model organism Arabidopsis thaliana. As a membrane protein, it likely plays roles in cellular signaling, transport, or structural organization of the membrane. The protein consists of 617 amino acids in its full-length form and has been produced recombinantly with a histidine tag in E. coli expression systems . Uncharacterized proteins like At1g75140 represent significant research opportunities as they may be involved in novel biological pathways or functions that have not yet been elucidated. Similar to other membrane proteins in Arabidopsis, At1g75140 may be involved in stress responses, development, or other critical physiological processes. The characterization of such proteins contributes to our fundamental understanding of plant biology and potentially identifies new targets for agricultural improvement.

What expression systems are suitable for producing recombinant At1g75140?

Expression SystemAdvantagesChallengesRecommended for At1g75140
E. coliRapid growth, high yields, economicalLimited post-translational modifications, challenges with membrane proteinsInitial characterization, structural studies
Yeast (S. cerevisiae, P. pastoris)Better for eukaryotic proteins, some PTMsLonger production time than bacteriaFunctional studies requiring some PTMs
Insect cellsGood PTM capability, better for complex proteinsMore complex to maintain, higher costDetailed functional studies
Plant expression systemsNative environment, all required PTMsLower yields, longer production timeIn vivo studies, interaction analyses

When expressing membrane proteins like At1g75140, the addition of detergents or lipid-based stabilization reagents is necessary throughout the purification and formulation processes to maintain protein stability and prevent aggregation .

What are the key challenges in expressing membrane proteins like At1g75140?

Expressing membrane proteins like At1g75140 presents several significant challenges compared to soluble proteins:

To address these challenges, researchers should optimize expression conditions, consider using membrane-mimetic environments, and implement careful purification strategies that maintain the native-like environment of the membrane protein.

How can I verify successful expression and purification of recombinant At1g75140?

Verification of successful expression and purification of recombinant At1g75140 should employ multiple complementary techniques:

  • SDS-PAGE analysis: Confirm the presence of a protein band at the expected molecular weight (~68 kDa for full-length At1g75140 plus His-tag). Compare with pre-induction samples to identify the overexpressed protein.

  • Western blotting: Use anti-His antibodies to specifically detect the His-tagged At1g75140 protein, confirming identity and integrity.

  • Mass spectrometry: Perform peptide mass fingerprinting or LC-MS/MS analysis of tryptic digests to confirm protein identity with high confidence.

  • Size exclusion chromatography: Assess the oligomeric state and homogeneity of the purified protein, particularly important for membrane proteins that may form aggregates.

  • Circular dichroism (CD) spectroscopy: Evaluate secondary structure to confirm proper folding, especially important after detergent solubilization steps.

For membrane proteins like At1g75140, additional verification steps should include detergent screening assays to identify optimal conditions for maintaining protein stability and function after extraction from membranes.

How can I determine the subcellular localization of At1g75140 in Arabidopsis thaliana?

Determining the subcellular localization of At1g75140 requires multiple complementary approaches:

  • GFP fusion protein expression: Create C-terminal GFP fusion constructs similar to the methodology used for At1g74450 . Transform Arabidopsis plants using Agrobacterium-mediated transformation with the pUB10:At1g75140:C-GFP construct. Select transformants using appropriate antibiotics and confirm transgene insertion by PCR.

  • Confocal microscopy analysis: Examine transformed plants using techniques similar to those described for At1g74450 . Specifically:

    • Grow seedlings vertically for 4-6 days

    • Use appropriate organelle-specific dyes as counterstains (e.g., MitoTracker Orange for mitochondria, FM4-64 for plasma membrane)

    • Image using confocal laser scanning microscopy with appropriate excitation/emission settings

    • Analyze co-localization with known membrane markers

  • Subcellular fractionation and immunoblotting: Isolate different membrane fractions (plasma membrane, tonoplast, ER, etc.) and perform western blotting using anti-At1g75140 antibodies or anti-tag antibodies if working with tagged versions.

  • Immunogold electron microscopy: For highest-resolution localization, perform immunogold labeling with anti-At1g75140 antibodies and examine using transmission electron microscopy.

Based on approaches used for other Arabidopsis membrane proteins, images should be collected on a confocal laser scanning microscope using a 63x 1.2 NA objective with appropriate laser settings (e.g., Argon 488 nm for GFP) .

What approaches can be used to characterize the function of uncharacterized membrane proteins like At1g75140?

Comprehensive functional characterization of At1g75140 requires a multi-faceted approach:

  • Reverse genetics approaches:

    • Generate and phenotype T-DNA insertion knockout lines

    • Create overexpression lines using 35S promoter-driven constructs

    • Develop inducible expression systems for temporal control

    • Utilize CRISPR-Cas9 for precise gene editing

  • Phenotypic analysis pipeline:

    • Assess plant development under standard conditions

    • Examine stress responses (similar to At1g74450 stress response studies)

    • Evaluate reproductive development and fertility

    • Analyze seed development and germination rates

  • Transcriptome analysis:

    • Perform RNA-Seq comparing wildtype and knockout/overexpression lines

    • Identify co-expressed genes that may suggest functional pathways

    • Analyze expression under various stress conditions

  • Protein interaction studies:

    • Conduct yeast two-hybrid screening with soluble domains

    • Perform co-immunoprecipitation experiments

    • Employ proximity labeling techniques (BioID, TurboID)

    • Use split-ubiquitin systems specifically designed for membrane proteins

  • Transport/channel activity assessment:

    • Conduct electrophysiological studies if channel function is suspected

    • Perform transport assays with labeled substrates

    • Utilize liposome reconstitution systems

These approaches should be integrated with bioinformatic analyses to develop and test hypotheses about At1g75140 function based on structural predictions, conservation patterns, and expression data.

How do I design experiments to investigate potential stress-responsive properties of At1g75140?

To investigate whether At1g75140 responds to environmental stresses similar to other Arabidopsis genes like At1g74450 , implement this systematic experimental design:

  • Expression analysis under stress conditions:

    • Subject wildtype Arabidopsis plants to various stresses (drought, salt, cold, heat, pathogen, oxidative)

    • Harvest tissue at multiple time points (0, 1, 3, 6, 12, 24 hours)

    • Perform RT-qPCR to quantify At1g75140 expression changes

    • Compare with known stress-responsive genes as positive controls

  • Promoter analysis:

    • Clone the At1g75140 promoter region (~2kb upstream) into a GUS reporter construct

    • Generate transgenic pAt1g75140:GUS plants

    • Expose to various stresses and perform histochemical staining

    • Analyze tissue-specific expression patterns during stress

  • Stress phenotyping of genetic lines:

    • Compare wildtype, knockout, and overexpression lines under stress conditions

    • Measure physiological parameters (relative water content, electrolyte leakage, chlorophyll fluorescence)

    • Assess growth parameters (root length, fresh weight, flowering time)

    • Quantify stress-related metabolites

  • Subcellular relocalization during stress:

    • Use At1g75140-GFP fusion lines to track protein localization before and during stress

    • Perform time-course imaging to identify dynamic changes in localization

Integrate these approaches to determine if At1g75140 shows patterns similar to the multiple-stress responsive gene At1g74450, which affects plant height and pollen development when overexpressed .

What are the best methods for analyzing protein-protein interactions involving membrane proteins like At1g75140?

Analyzing protein-protein interactions for membrane proteins requires specialized approaches that accommodate their hydrophobic nature:

  • Membrane-specific yeast two-hybrid systems:

    • Split-ubiquitin membrane yeast two-hybrid (MYTH)

    • DUAL membrane system

    • G-protein fusion technique

  • In vivo proximity labeling:

    • BioID: Fusion of biotin ligase to At1g75140 to biotinylate proximal proteins

    • APEX2: Peroxidase-based proximity labeling followed by mass spectrometry

    • TurboID: Enhanced biotin ligase for faster labeling kinetics

  • Co-immunoprecipitation adaptations:

    • Crosslinking before membrane solubilization

    • Detergent screening to maintain interactions

    • GFP-Trap or His-tag pulldown from solubilized membranes

  • Advanced imaging techniques:

    • Förster Resonance Energy Transfer (FRET)

    • Bimolecular Fluorescence Complementation (BiFC)

    • Fluorescence Lifetime Imaging Microscopy (FLIM)

  • Proteoliposome reconstitution:

    • Co-reconstitute purified At1g75140 with candidate interactors

    • Perform pull-down assays in the controlled lipid environment

MethodAdvantagesLimitationsBest Used For
Split-ubiquitin MYTHIn vivo, specific for membrane proteinsSome false positives, limited to yeastScreening interaction partners
BioID/TurboIDCaptures transient interactions, works in native environmentMay label non-specific proximal proteinsIdentifying entire interactome
FRET/FLIMDirect visualization in living cellsTechnically challenging, requires specialized equipmentConfirming specific interactions
Co-IP with crosslinkingCan capture native complexesMay disrupt some interactions during solubilizationValidating specific interactions

The combination of multiple complementary approaches provides the most robust characterization of protein-protein interactions for membrane proteins like At1g75140.

How can I optimize recombinant At1g75140 expression to overcome protein degradation and instability issues?

Optimizing expression of membrane proteins like At1g75140 requires addressing the specific challenges of membrane protein production:

  • Expression vector optimization:

    • Test different fusion tags (His, MBP, GST, SUMO) to improve solubility

    • Explore inducible promoters with tunable expression levels

    • Consider codon optimization for the host organism

    • Include protease cleavage sites for tag removal

  • Host strain selection:

    • Use E. coli strains designed for membrane proteins (C41/C43, Lemo21)

    • Test strains with different membrane compositions

    • Consider hosts with reduced protease activity (BL21, HT115)

  • Expression condition optimization:

    • Reduce induction temperature (16-20°C) to slow expression rate

    • Test different inducer concentrations for optimal expression level

    • Extend expression time to allow proper membrane integration

    • Screen media compositions to support membrane protein folding

  • Stabilization strategies:

    • Add specific lipids or lipid mixtures to support membrane protein folding

    • Include osmolytes (glycerol, sucrose) to stabilize protein structure

    • Test various detergents for membrane extraction and stabilization

    • Consider nanodiscs or other membrane mimetics for final formulation

  • Purification process optimization:

    • Implement rapid purification protocols to minimize degradation time

    • Include protease inhibitors throughout all steps

    • Maintain constant detergent concentration above critical micelle concentration

    • Consider on-column detergent exchange during purification

These approaches address the specific challenges of membrane protein expression, including the tendency of transmembrane domains to cause protein instability and the risk of host cell physiological changes due to overexpression .

What might cause low yields of recombinant At1g75140 and how can I address this issue?

Low yields of recombinant At1g75140 can stem from multiple factors related to its nature as a membrane protein:

  • Toxicity to host cells:

    • Symptoms: Slow growth after induction, cell lysis, plasmid loss

    • Solutions: Reduce expression temperature to 16-18°C, use tightly controlled inducible promoters, test lower inducer concentrations, use specialized strains like C41/C43

  • Protein aggregation/inclusion body formation:

    • Symptoms: Protein found primarily in insoluble fraction

    • Solutions: Reduce expression rate by lowering temperature and inducer concentration, co-express with chaperones, add membrane-stabilizing agents to growth media

  • Proteolytic degradation:

    • Symptoms: Multiple bands or smears on Western blot, lower than expected molecular weight

    • Solutions: Add protease inhibitors, use protease-deficient strains, optimize lysis and purification buffers, reduce purification time

  • Poor membrane integration:

    • Symptoms: Low yield despite good expression level

    • Solutions: Optimize membrane extraction methods, screen different detergents, consider using specialized membrane protein purification kits

  • Co-purifying contaminants:

    • Symptoms: Multiple bands on SDS-PAGE despite purification

    • Solutions: Implement multi-step purification strategy, optimize imidazole concentration in washes, consider on-column detergent exchange

Systematically addressing these issues through condition screening and optimization can significantly improve recombinant At1g75140 yields and quality.

How can I differentiate between functional and non-functional recombinant At1g75140?

Assessing the functionality of recombinant At1g75140 is challenging due to its uncharacterized nature, but several approaches can help differentiate properly folded, functional protein from non-functional forms:

  • Biophysical characterization:

    • Circular dichroism (CD) to assess secondary structure content

    • Thermal shift assays to determine stability and proper folding

    • Size exclusion chromatography to evaluate oligomeric state

    • Dynamic light scattering to assess homogeneity

  • Functional reconstitution:

    • Incorporate purified At1g75140 into liposomes or nanodiscs

    • Measure membrane integrity using dye leakage assays

    • Assess lipid bilayer effects using electrical measurements

  • Binding assays:

    • Perform ligand binding studies if potential ligands are identified

    • Use thermal shift assays in the presence of potential stabilizing ligands

    • Conduct co-precipitation studies with known or predicted interactors

  • Structure validation:

    • Limited proteolysis to assess domain folding and accessibility

    • Hydrogen-deuterium exchange mass spectrometry to examine protein dynamics

    • Negative-stain electron microscopy to visualize protein particles

  • In vivo complementation:

    • Express recombinant At1g75140 in knockout lines

    • Assess restoration of wildtype phenotype if any phenotypes are identified

These approaches provide complementary data about protein quality and can help establish criteria for distinguishing functional from non-functional recombinant At1g75140 preparations.

How might comparative studies with related proteins inform At1g75140 function?

Understanding At1g75140 function can be enhanced through systematic comparative analyses:

  • Phylogenetic profiling:

    • Identify homologs across plant species with varying evolutionary distances

    • Compare conservation patterns, particularly in transmembrane regions

    • Identify species-specific adaptations that might suggest functional specialization

  • Co-expression network analysis:

    • Compare co-expression patterns across multiple plant species

    • Identify conserved co-expression modules that might indicate functional pathways

    • Look for enriched Gene Ontology terms in conserved co-expression networks

  • Domain architecture comparison:

    • Analyze presence/absence of specific domains across homologs

    • Identify conserved motifs that might be functionally important

    • Compare with better-characterized membrane proteins sharing similar domains

  • Expression pattern comparison:

    • Compare tissue-specific and stress-responsive expression patterns

    • Identify conditions where expression patterns diverge between homologs

    • Look for correlation with specific physiological or developmental processes

Similar to the approach used for At1g74450, researchers could investigate homologs in sister species like Arabidopsis lyrata, Capsella rubella, and Eutrema salsugineum to gain functional insights through comparative studies .

What emerging technologies might accelerate characterization of proteins like At1g75140?

Emerging technologies that could significantly advance the characterization of uncharacterized membrane proteins like At1g75140 include:

  • Cryo-electron microscopy advancements:

    • Single-particle analysis for membrane proteins in nanodiscs or detergent micelles

    • Tomography methods for visualizing proteins in native membrane environments

    • Microcrystal electron diffraction for structural determination

  • AlphaFold and machine learning approaches:

    • Improved structure prediction specifically for membrane proteins

    • Functional annotation based on structural features

    • Interaction partner prediction based on surface complementarity

  • High-throughput phenomics:

    • Automated phenotyping of mutant lines under multiple conditions

    • Machine learning-based image analysis to detect subtle phenotypes

    • Integration of multiple "-omics" datasets for functional prediction

  • Single-cell technologies:

    • Single-cell transcriptomics to identify cell-type specific expression

    • Spatial transcriptomics to map expression patterns with high resolution

    • Single-cell proteomics to detect low-abundance membrane proteins

  • Cell-free expression systems:

    • Specialized membrane protein expression systems with nanodiscs or liposomes

    • High-throughput screening of conditions using cell-free systems

    • Direct incorporation into membrane mimetics during synthesis

These technologies promise to overcome current bottlenecks in membrane protein characterization and could provide unprecedented insights into the structure, function, and biological roles of At1g75140.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.