Recombinant Arabidopsis thaliana Uncharacterized membrane protein At3g27390 (At3g27390)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant protein is synthesized in E. coli expression systems, followed by affinity chromatography. Commercial vendors provide it in lyophilized or solution forms, with storage recommendations at -20°C or -80°C . Key production details:

ParameterSpecification
Host SystemE. coli
Purity>90% (SDS-PAGE verified)
Storage BufferTris-based, 50% glycerol
ApplicationsAntibody development, structural studies

Despite its availability, functional characterization remains limited, as noted by the absence of peer-reviewed studies in vendor descriptions .

Expression and Localization

  • Native Expression: Endogenous At3g27390 is expressed in guard cells, root tips, and leaf primordia, as shown by GFP enhancer trap lines .

  • Promoter Activity: A 2.3 kb promoter fragment drives β-glucuronidase (GUS) expression in vascular tissues, guard cells, and roots, suggesting roles in development or stress responses .

Functional Insights and Interactions

While the protein’s exact function is uncharacterized, several clues emerge:

  • Ubiquitination Sites: At3g27390 harbors lysine residues prone to ubiquitination, hinting at regulatory post-translational modifications .

  • Membrane Association: Predicted transmembrane domains suggest involvement in signaling or transport .

  • Genetic Context: Proximity to receptor-like kinases (e.g., LRR-VIIa family proteins) implies potential interaction networks .

Challenges in Recombinant Production

Membrane proteins like At3g27390 often require specialized refolding strategies to maintain activity. Methods such as:

  • Oxidative refolding matrices (e.g., GroEL minichaperone)

  • Chemical additives (e.g., arginine, proline) to prevent aggregation

Future Research Directions

Priority AreaObjective
Functional AnnotationElucidate roles in stress or development
Structural AnalysisCryo-EM or crystallography studies
Interaction MappingIdentify binding partners via yeast two-hybrid screens

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, and aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of the specified tag.
Synonyms
At3g27390; K1G2.10; Uncharacterized membrane protein At3g27390
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-588
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At3g27390
Target Protein Sequence
MEPPIGFRASLFQFLLFLPYFIGLLFLGFIKGIVLCPLVCLVVTIGNSAVILSLLPVHIV WTFYSIVSAKQVGPILKIFLCLCLPAAIILWPIVGILGSVLGGALYGFFSPIFATFDAVG EGKPYQFFHCFYDGTWSTMQRSFTVVRDFKDVCFHSYFSLMDELKQSCPDRKYYEIRLLQ LPGALVVSVLGILVDPPVISLVAICKSPYMLFKGWHRLFHDLIGREGPFLETMCVPIAGL AILLWPLAVTGAVIGSVISSIFLGAYAGVVSYQESSFYYGLCYIVASVSIYDEYSTDILD LPEGSCFPRPKYRRKDEEPTPFSGPVPRLGSVKNASSMRGGSVRVPMIDIKPLDLLNELF VECRRYGEVLATKGLINSKDIEEARSSKGSQVISVGLPAYGLLYEILRSVKANSSGLLLS DGVTEITTMNRPKDVFFDWFLNPFLILKEQMKATNLSEEEEEYLGRLVLLFGDPERLKSS NAISASPPLTERKRAELDAFARRMQGLTKTVSRYPTFRRHFVALVKKLSEDLDLKDNNSA KDESITEPPAPVKIISRIFSQRSFRRKGSVNGSDQESQKGVSRNVDIV
Uniprot No.

Target Background

Database Links

KEGG: ath:AT3G27390

STRING: 3702.AT3G27390.1

UniGene: At.37069

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the At3g27390 protein and what are its basic characteristics?

At3g27390 is an uncharacterized membrane protein from Arabidopsis thaliana with UniProt ID Q8GUM4. It consists of 588 amino acids and has several predicted transmembrane domains based on its sequence characteristics. The protein is encoded by the At3g27390 gene, also known as K1G2.10, and is classified as a membrane protein, though its specific function remains to be fully elucidated. The full amino acid sequence reveals multiple hydrophobic regions consistent with membrane-spanning domains, suggesting its integration into cellular membranes .

How is recombinant At3g27390 protein typically expressed and purified?

Recombinant At3g27390 protein is commonly expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification. The full-length protein (1-588 amino acids) can be successfully expressed in bacterial systems despite being a membrane protein, which typically presents challenges for heterologous expression. The His-tagged protein can be purified using affinity chromatography techniques, with the final product typically supplied as a lyophilized powder in Tris/PBS-based buffer containing 6% trehalose at pH 8.0 .

What are the optimal storage and handling conditions for purified At3g27390?

For optimal stability, purified At3g27390 should be stored at -20°C to -80°C upon receipt, with proper aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles. For reconstitution, the lyophilized protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of glycerol to a final concentration of 5-50% (with 50% being the default recommendation) is advised for long-term storage at -20°C or -80°C. Working aliquots can be maintained at 4°C for up to one week, but repeated freezing and thawing is not recommended as it may compromise protein integrity .

How can reporter systems be designed to study At3g27390 expression under different conditions?

Reporter systems for studying At3g27390 expression can be designed using approaches similar to the HIBAT (Heat-Inducible Bioluminescence And Toxicity) system developed for heat-shock protein studies in Arabidopsis. This would involve:

  • Identifying the promoter region of At3g27390

  • Cloning this promoter upstream of a reporter gene such as nanoluciferase (nLUC)

  • Transforming Arabidopsis plants using established protocols like floral-dip method

  • Selecting transformants based on appropriate markers

  • Validating reporter activity under different conditions

This approach allows for real-time monitoring of gene expression in response to various stimuli, such as environmental stresses or developmental cues. The HIBAT system demonstrates how bioluminescence can be effectively used as a sensitive readout for conditional gene expression in Arabidopsis .

What approaches can elucidate potential chromatin-level regulation of At3g27390?

Investigation of chromatin-level regulation of At3g27390 can benefit from methodologies used in studying chromatin remodelers like DEK3 in Arabidopsis. Potential approaches include:

  • Chromatin Immunoprecipitation (ChIP): To identify transcription factors or chromatin modifiers that bind to the At3g27390 promoter region

  • DNase I hypersensitivity assays: To determine chromatin accessibility at the At3g27390 locus

  • Histone modification analysis: To examine epigenetic marks associated with At3g27390 expression

  • Chromosome Conformation Capture (3C): To investigate three-dimensional chromatin interactions affecting At3g27390 regulation

These methods would help determine if At3g27390 expression is regulated by specific chromatin architectural proteins, histone modifications, or nucleosome positioning, similar to the regulation observed for other genes in Arabidopsis thaliana .

What are the challenges in structural characterization of membrane proteins like At3g27390?

Structural characterization of membrane proteins like At3g27390 presents several challenges:

  • Expression and purification: Membrane proteins often express poorly in heterologous systems and may form inclusion bodies

  • Protein stability: Maintaining native conformation outside of the membrane environment is difficult

  • Crystallization: Membrane proteins are notoriously difficult to crystallize due to their hydrophobic surfaces

  • Data interpretation: Even when structural data is obtained, interpreting the functional significance can be challenging

To address these challenges, researchers can employ strategies such as:

  • Using specialized detergents or lipid nanodiscs to mimic membrane environments

  • Exploring alternative structural determination methods such as cryo-electron microscopy

  • Focusing on individual domains rather than the full-length protein

  • Combining computational prediction with experimental validation

How can genetic modification approaches be used to study At3g27390 function?

Genetic modification approaches to study At3g27390 function may include:

CRISPR-Cas9 Gene Editing:

  • Design guide RNAs targeting At3g27390

  • Transform Arabidopsis plants using established methods like floral dip

  • Screen transformants for successful editing

  • Analyze phenotypic changes in knockout or knockdown lines

Overexpression Studies:

  • Clone the At3g27390 coding sequence into a plant expression vector

  • Transform Arabidopsis plants

  • Select lines with varying levels of overexpression

  • Assess phenotypic consequences

Complementation Assays:
These can validate gene function by reintroducing the wild-type gene into knockout mutants to rescue the phenotype.

The transformation methodology would follow established protocols similar to those used for generating the HIBAT reporter line, involving Agrobacterium-mediated transformation followed by seed selection using appropriate markers .

What analytical techniques are most effective for studying At3g27390 protein interactions?

For studying At3g27390 protein interactions, several analytical techniques can be employed:

TechniqueApplicationAdvantagesLimitations
Co-immunoprecipitationIdentify in vivo protein partnersPreserves native complexesRequires specific antibodies
Yeast two-hybridScreen for potential interactorsHigh-throughput capabilityMay miss membrane protein interactions
Bimolecular Fluorescence ComplementationVisualize interactions in living cellsShows spatial context of interactionsMay cause artifactual associations
Surface Plasmon ResonanceMeasure binding kineticsProvides quantitative dataRequires purified proteins
Proximity-dependent Biotin IdentificationIdentify proximal proteins in cellular contextWorks well for membrane proteinsMay identify proximal but non-interacting proteins

For membrane proteins like At3g27390, specialized approaches such as split-ubiquitin yeast two-hybrid or membrane protein-specific pull-down assays may be more effective than conventional interaction assays designed for soluble proteins .

How can transcriptomics be utilized to understand At3g27390 function?

Transcriptomic approaches to understand At3g27390 function could include:

  • RNA-Seq Analysis of Knockout/Knockdown Lines:

    • Generate At3g27390 knockout or knockdown lines

    • Perform RNA-Seq under various conditions

    • Identify differentially expressed genes

    • Conduct pathway enrichment analysis

  • Time-Course Expression Analysis:

    • Subject plants to various stresses or developmental stages

    • Sample at multiple time points

    • Analyze temporal expression patterns

    • Identify co-regulated genes

  • Tissue-Specific Expression Profiling:

    • Isolate RNA from different tissues

    • Compare expression patterns

    • Identify tissue-specific functions

How can At3g27390 be studied in the context of stress response pathways?

Studies of At3g27390 in stress response contexts could utilize approaches similar to those employed in heat stress research:

  • Stress Treatment Protocols:

    • Subject plants to controlled stress conditions (heat, cold, drought, salt)

    • Monitor At3g27390 expression changes using qRT-PCR or reporter lines

    • Compare wild-type and At3g27390 mutant responses

  • Phenotypic Assays:

    • Conduct survival rate analysis following stress exposure

    • Measure physiological parameters (photosynthetic efficiency, ROS production)

    • Assess growth recovery post-stress

  • Stress-Specific Reporter Systems:

    • Develop conditional reporter systems similar to HIBAT

    • Use stress-specific promoters to drive reporter gene expression

    • Monitor real-time responses to stress treatments

Researchers could adapt the heat treatment protocols used in the HIBAT system, which included controlled exposure in growth chambers and thermoblocks with specific timing and temperature regimens .

What computational approaches can predict the function of uncharacterized proteins like At3g27390?

Several computational approaches can be employed to predict At3g27390 function:

  • Sequence Homology Analysis:

    • BLAST searches against characterized proteins

    • Multiple sequence alignments to identify conserved domains

    • Phylogenetic analysis to establish evolutionary relationships

  • Structural Prediction:

    • Ab initio modeling

    • Homology modeling based on related proteins

    • Transmembrane domain prediction

  • Protein-Protein Interaction Networks:

    • Prediction of interaction partners based on co-expression data

    • Integration with known protein complexes

    • Analysis of subcellular co-localization patterns

  • Functional Annotation Tools:

    • Gene Ontology term prediction

    • Pathway association analysis

    • Domain-based function prediction

These approaches would help generate testable hypotheses about At3g27390 function, guiding experimental design for biochemical and genetic validation studies .

How might At3g27390 interact with chromatin architecture and gene expression regulation?

While At3g27390 is annotated as a membrane protein, it could potentially influence gene expression through:

  • Signal Transduction:

    • Membrane proteins often function in signaling cascades that ultimately affect nuclear events

    • At3g27390 could be involved in transmitting external stimuli to chromatin regulators

  • Protein-Protein Interactions:

    • Potential interaction with cytoplasmic proteins that shuttle between membrane and nucleus

    • Possible involvement in stress-responsive pathways that alter chromatin states

  • Membrane-Nuclear Connections:

    • Some membrane proteins have domains that can be cleaved and translocated to the nucleus

    • At3g27390 might function in a pathway similar to regulated intramembrane proteolysis

Research approaches could include techniques used to study chromatin architectural proteins like DEK3, such as biochemical and biophysical analyses of protein interactions with histones and DNA, or investigation of conformational changes upon interaction with nuclear components .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.