Recombinant Arabidopsis thaliana Uncharacterized mitochondrial cytochrome b-like protein AtMg00590 (AtMg00590)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Arabidopsis thaliana uncharacterized mitochondrial cytochrome b-like protein AtMg00590 (AtMg00590) is a protein that is found in the mitochondria of the plant Arabidopsis thaliana . It is also known as ORF313 . AtMg00590 is a transmembrane protein and a cytochrome b-like protein, but its exact function is not yet known . Cytochrome b proteins are components of the electron transport chain, which is essential for energy production in mitochondria .

Subcellular Localization

AtMg00590 is localized to the mitochondria in Arabidopsis thaliana . Mitochondria are organelles responsible for ATP production and other key metabolic functions . Many proteins found in mitochondria are encoded by the nuclear genome, with only a small percentage being produced directly within the mitochondria .

Potential Functions and Roles

While AtMg00590 is currently annotated as an uncharacterized protein, its classification as a cytochrome b-like protein suggests it may play a role in the electron transport chain within mitochondria . Further research indicates that mitochondrial proteins like AtMg00590 are crucial for various functions, including:

  • Respiratory electron transport

  • Tricarboxylic acid cycle metabolism

  • Amino acid metabolism

  • Protein import, processing, and assembly

  • Membrane transport

  • Antioxidant defense

Related Research

Research has been conducted on other mitochondrial proteins in Arabidopsis thaliana, providing context for understanding the potential roles of AtMg00590.

  • MIA40: Arabidopsis thaliana MIA40 is targeted to both mitochondria and peroxisomes, and it affects several proteins in those organelles .

  • Prohibitins: Type-I prohibitins (AtPHB3 and AtPHB4) are involved in mitochondrial function and biogenesis, supporting cell division and differentiation in apical tissues .

  • LETM1: LETM proteins play a role in the accumulation of mitochondrially encoded proteins .

  • AtKP1: AtKP1, a kinesin-like protein, mainly localizes to mitochondria in Arabidopsis thaliana .

Methods of Study

  • Proteomic Analysis: Proteomic approaches, including two-dimensional gel electrophoresis and mass spectrometry, have been used to identify and characterize mitochondrial proteins in Arabidopsis .

  • Bioinformatics Tools: Bioinformatics tools like TargetP, Psort, and MitoProt are used to predict subcellular targeting of proteins .

  • Reverse Genetics: Reverse genetic approaches, such as insertional mutagenesis, can be used to study the function of AtMg00590 by creating knockout mutants .

  • Transcriptomic Analysis: Transcriptomic analysis can reveal changes in gene expression in response to inactivation or overexpression of AtMg00590 .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
AtMg00590; At2g07718; Uncharacterized mitochondrial cytochrome b-like protein AtMg00590; ORF313
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-313
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
AtMg00590;
Target Protein Sequence
MTIRNQRFSLLKQPISSTLNQHLVDYPTPSNLSYWWGFGPLAGTMILSVLSSPALVSGLM VARAKNLVHSVLFPIPIFFSINQLFHYFCRLPIIKHLATKCQLLLFLISHFLLLLVLTKL VLDLGGYLFMDDLSRALSQFVPGFSGGLGGGSNTPPNPSGDFFLSSYQTSDPDYHDQRRG DSYFSSAPGVQETHRHASGSSTNLHLNLNDQSQDPIFLEVERLSLKCDKVKEKTILKTQS LLLERGYHIPDERDIERAINVVMTEHETIDIDRRRKRFYYLYSCLGKTGNKFWMELLETL ADYNINIKSDSDN
Uniprot No.

Target Background

Database Links

KEGG: ath:ArthMp052

STRING: 3702.ATMG00590.1

UniGene: At.70117

Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

How does AtMg00590 relate to mitochondrial retrograde signaling pathways?

AtMg00590, as a putative component of the respiratory electron transport chain, likely influences mitochondrial retrograde signaling through several interconnected mechanisms. Mitochondrial retrograde signaling involves communication from mitochondria to the nucleus that affects nuclear gene expression based on organellar status. Several lines of evidence suggest potential roles for AtMg00590 in this process. First, disruptions in electron transport chain components often generate reactive oxygen species (ROS), which serve as important retrograde signals . These ROS can activate nuclear transcription factors such as ANAC013 and ANAC017, which regulate the expression of mitochondrial dysfunction stimulon (MDS) genes . Second, proteins involved in electron transport, like cytochrome b, contribute to the maintenance of mitochondrial membrane potential, which also influences retrograde signaling pathways. Third, the function of AtMg00590 may be integrated with nuclear factors like RCD1, which has been identified as a coordinator of chloroplast and mitochondrial functions . RCD1 forms inhibitory complexes with components of mitochondrial retrograde signaling and is itself influenced by chloroplastic ROS . Experimental approaches to study AtMg00590's role in retrograde signaling would include analyzing nuclear transcriptional responses to AtMg00590 perturbation, measuring ROS production, and investigating interactions with known retrograde signaling components.

What methods are available for isolating and characterizing recombinant AtMg00590?

Isolation and characterization of recombinant AtMg00590 requires specialized approaches due to its nature as a mitochondrial membrane protein. A comprehensive strategy would include:

  • Expression system selection:

    • Bacterial systems: E. coli strains designed for membrane protein expression (C41, C43) with reduced growth temperatures (16-18°C)

    • Eukaryotic systems: Yeast (S. cerevisiae, P. pastoris) or insect cells for better folding

  • Construct design considerations:

    • Codon optimization for the chosen expression system

    • Addition of affinity tags (His, Strep) for purification

    • Use of solubility-enhancing fusion partners (MBP, SUMO)

    • Inclusion of protease cleavage sites for tag removal

  • Purification strategy:

    • Membrane solubilization using mild detergents (DDM, LMNG)

    • Affinity chromatography as initial purification step

    • Size exclusion chromatography for homogeneity assessment

    • Consideration of amphipol or nanodisc reconstitution for stability

  • Characterization approaches:

    • Spectroscopic analysis for heme incorporation

    • Activity assays measuring electron transfer

    • Thermal stability assessment

    • Structural studies (cryo-EM, X-ray crystallography)

For mitochondrial cytochrome proteins, special consideration should be given to maintaining heme incorporation by supplementing growth media with delta-aminolevulinic acid and performing purification under reduced oxygen conditions . Protein quality should be assessed using multiple methods including SDS-PAGE, spectroscopic analysis, and functional assays to ensure proper folding and activity.

How can CRISPR-Cas9 be effectively used to study AtMg00590 function?

Employing CRISPR-Cas9 technology to study AtMg00590 presents unique challenges due to its mitochondrial genome location. A comprehensive experimental strategy would involve:

  • Guide RNA (gRNA) design and optimization:

    • Design multiple gRNAs targeting different regions of AtMg00590

    • Ensure high specificity to minimize off-target effects

    • Consider using paired gRNAs for more efficient editing

    • Evaluate gRNA efficiency using predictive algorithms

Students in course-based undergraduate research experiences have achieved 86% success rates in designing effective gRNA pairs for Arabidopsis targets, demonstrating that well-designed CRISPR approaches can be implemented by researchers at various experience levels .

  • Delivery system development:

    • Create constructs containing Cas9, gRNA expression cassettes, and selection markers

    • For mitochondrial genome editing, consider specialized approaches:
      a) Mitochondria-targeted Cas9 with appropriate localization signals
      b) Alternative systems like mitoTALENs if direct CRISPR editing proves challenging

  • Transformation and screening:

    • Use Agrobacterium-mediated transformation for introducing CRISPR components

    • Implement efficient screening protocols for identifying edited plants

    • Develop PCR-based genotyping methods for mutation detection

    • Sequence verification of editing outcomes

  • Phenotypic characterization:

    • Apply standardized growth stage-based phenotyping as established for Arabidopsis

    • Include specialized assays for mitochondrial function (respiration, membrane potential)

    • Analyze retrograde signaling through reporter constructs or transcriptomics

  • Validation approaches:

    • Perform complementation studies with wild-type gene to confirm phenotype causality

    • Create multiple independent mutant lines to establish consistency

    • Use conditional systems to distinguish between developmental and physiological roles

The experimental design should include appropriate controls and alternative approaches for mitochondrial gene manipulation in case direct editing proves technically challenging .

What techniques are recommended for analyzing the interaction between AtMg00590 and chloroplast function?

The coordination between mitochondria and chloroplasts is essential for plant energy metabolism, and proteins like AtMg00590 may contribute to this inter-organellar communication. The following techniques are recommended for investigating this relationship:

  • Physiological measurements:

    • Simultaneous assessment of photosynthetic and respiratory parameters

    • Chlorophyll fluorescence analysis (Fv/Fm, ETR, NPQ) to measure photosystem II efficiency

    • Gas exchange measurements to quantify CO2 assimilation and O2 consumption

    • Measurement of ATP/ADP ratios in different cellular compartments

  • Metabolic profiling:

    • Targeted analysis of metabolites shared between organelles (malate, oxaloacetate, pyruvate)

    • 13C labeling experiments to track metabolite movement between compartments

    • Enzymatic assays for key enzymes in shared metabolic pathways

  • Stress response analysis:

    • Application of specific inhibitors to mitochondria (antimycin A, myxothiazol) to assess effects on chloroplast function

    • Use of photosynthetic inhibitors to evaluate impacts on mitochondrial processes

    • ROS detection in both organelles using specific probes

  • Genetic interaction studies:

    • Creation of double mutants affecting both organelles

    • Analysis of epistatic relationships between AtMg00590 and chloroplast-related genes

    • Investigation of potential interactions with RCD1, which coordinates chloroplast and mitochondrial functions

  • Transcriptomic and proteomic analyses:

    • RNA-seq to identify co-regulated nuclear genes encoding proteins for both organelles

    • Proteomics to detect changes in chloroplast protein abundance in AtMg00590 mutants

    • Analysis of protein post-translational modifications across both organelles

Previous research has demonstrated that mitochondrial inhibitors like antimycin A can influence chloroplast function through retrograde signaling pathways, and these effects are altered in plants with disrupted signaling components like RCD1 . Similar experimental approaches would be valuable for determining AtMg00590's role in mitochondria-chloroplast communication.

How should researchers design experiments to analyze m6A methylation patterns in AtMg00590 transcripts?

Analysis of m6A methylation in mitochondrial transcripts like AtMg00590 requires specialized techniques to isolate organellar RNA and detect modified nucleotides. A comprehensive experimental strategy would include:

  • Mitochondrial RNA isolation:

    • Differential centrifugation to isolate intact mitochondria

    • RNA extraction with high purity to avoid nuclear/chloroplast contamination

    • DNase treatment to remove mitochondrial DNA

    • Quality assessment using bioanalyzer or gel electrophoresis

  • m6A-seq methodology:

    • RNA fragmentation to ~100-150 nucleotides

    • Immunoprecipitation using anti-m6A antibodies

    • Library preparation of input and immunoprecipitated fractions

    • High-throughput sequencing (minimum 20 million reads per sample)

    • Specialized bioinformatic analysis

High-throughput m6A-seq has revealed that over 86% of transcripts in Arabidopsis mitochondria are methylated by m6A, with approximately 4.6 to 4.9 m6A sites per transcript . This suggests AtMg00590 likely contains multiple methylation sites that may influence its expression and processing.

  • Site-specific validation techniques:

    • SCARLET (site-specific cleavage and radioactive labeling followed by ligation-assisted extraction)

    • SELECT (single-base elongation and ligation-based qPCR amplification)

    • RT-qPCR validation of selected sites

  • Functional analysis approaches:

    • Site-directed mutagenesis of m6A sites followed by expression analysis

    • Assessment of transcript stability and translation efficiency

    • Investigation of potential m6A reader protein binding

  • Comparative analysis design:

    • Comparison across different developmental stages

    • Analysis under various stress conditions

    • Examination in nuclear gene expression mutants affecting RNA methylation

The experimental design should include appropriate controls and consider the potential impact of growth conditions and developmental stage on methylation patterns, as these can significantly influence RNA modifications .

How can researchers distinguish between direct and indirect effects when studying AtMg00590 mutant phenotypes?

Distinguishing direct from indirect effects in AtMg00590 mutants requires a systematic approach incorporating multiple lines of evidence. The following methodological framework is recommended:

  • Temporal analysis strategy:

    • Implement time-course experiments to identify the earliest detectable changes

    • Monitor progression of phenotypes from molecular to cellular to organismal levels

    • Use inducible systems to trigger AtMg00590 disruption and track immediate responses

    • Apply standardized growth stage-based phenotyping as established for Arabidopsis functional genomics

  • Molecular proximity assessment:

    • Analyze changes in processes directly linked to AtMg00590's predicted function

    • Compare with more distant pathways that may show secondary effects

    • Use metabolic flux analysis to trace primary metabolic perturbations

  • Genetic complementation strategy:

    ApproachImplementationExpected Outcome for Direct Effects
    Full complementationWild-type AtMg00590 expressionComplete phenotype rescue
    Domain-specific complementationModified versions with specific domains intactPartial rescue of domain-related functions
    Temporal complementationStage-specific expressionRescue only during expression period
    Spatial complementationTissue-specific expressionRescue in expressing tissues only
  • Dose-response relationship:

    • Generate multiple alleles with varying levels of AtMg00590 function

    • Create dosage series using inducible expression systems

    • Quantify phenotypic severity in relation to AtMg00590 activity levels

  • Comparative mutant analysis:

    • Compare with phenotypes of other respiratory chain component mutants

    • Analyze overlap with retrograde signaling mutant phenotypes

    • Evaluate similarity to plants treated with mitochondrial inhibitors like antimycin A

This multifaceted approach enables researchers to build a causality model that distinguishes primary effects of AtMg00590 disruption from secondary consequences, compensatory responses, and potential experimental artifacts .

What approaches should be used to investigate the role of AtMg00590 in oxidative stress responses?

Oxidative stress is a key challenge for mitochondrial function, and understanding how AtMg00590 contributes to stress responses requires integrated experimental approaches:

  • Transcriptional and post-transcriptional regulation:

    • Quantify AtMg00590 transcript levels under various oxidative stress conditions using RT-qPCR

    • Analyze m6A methylation patterns in response to stress using m6A-seq

    • Evaluate transcript stability and processing through chase experiments

    • Investigate potential stress-responsive promoter elements

  • Protein-level analyses:

    • Measure AtMg00590 protein abundance and turnover rates under stress

    • Assess post-translational modifications using mass spectrometry

    • Analyze potential redox-dependent changes in protein state

    • Investigate potential stress-induced changes in protein interactions

  • Functional assessment under stress:

    • Compare wild-type and mutant responses to oxidative stress agents:

      • Methyl viologen (paraquat) for chloroplast-derived ROS

      • Antimycin A for mitochondrial complex III inhibition

      • Hydrogen peroxide for generalized oxidative stress

    • Measure electron transport chain activity and efficiency

    • Quantify ROS production using specific fluorescent probes

    • Assess mitochondrial membrane potential during stress response

  • Integration with known stress pathways:

    • Analyze expression of alternative oxidases (AOXs) in AtMg00590 mutants

    • Investigate interaction with RCD1 and related proteins

    • Evaluate relationship with ANAC013/ANAC017 transcription factors

    • Determine effects on nuclear gene expression through transcriptomics

  • Cross-organellar coordination:

    • Measure photosystem II efficiency (Fv/Fm) in response to mitochondrial stress

    • Analyze chloroplast redox state during mitochondrial perturbation

    • Investigate metabolite exchange between organelles under stress conditions

Previous research has shown that disruptions in mitochondrial function can significantly affect chloroplast responses to oxidative stress through retrograde signaling pathways . Similar integrated approaches would reveal whether AtMg00590 plays a role in coordinating inter-organellar responses to oxidative challenges.

What bioinformatic strategies can identify potential functional domains and evolutionary relationships of AtMg00590?

A comprehensive bioinformatic analysis of AtMg00590 requires multiple computational approaches to predict functional domains, evolutionary relationships, and potential functions:

  • Sequence-based domain prediction:

    • Profile-based methods (HMMER, PFAM) to identify conserved domains

    • Secondary structure prediction (PSIPRED, JPred) to identify transmembrane regions

    • Motif scanning for potential cofactor binding sites, particularly heme-binding motifs

    • Signal peptide and targeting sequence analysis (TargetP, MitoProt)

  • Evolutionary analysis workflow:

    • Homology searches across diverse plant species using BLAST and HMMer

    • Multiple sequence alignment of homologs using MAFFT or MUSCLE

    • Calculation of conservation indices for individual residues

    • Phylogenetic tree construction to establish evolutionary relationships

    • Genomic synteny analysis to identify conserved gene neighborhoods

  • Structural prediction and analysis:

    • Template-based modeling using known cytochrome b structures

    • Ab initio modeling for unique regions using Rosetta or AlphaFold

    • Analysis of potential electron transport pathways through the protein

    • Identification of potential protein-protein interaction interfaces

    • Prediction of functionally important residues through conservation mapping

  • Coevolution and coexpression analysis:

    • Identification of genes showing correlated expression patterns

    • Prediction of functional associations using STRING database

    • Analysis of coevolving residues that may indicate functional coupling

    • Integration with known mitochondrial protein interaction networks

  • Comparative genomics approaches:

    • Analysis of conservation across mitochondrial genomes

    • Identification of residues under selective pressure (dN/dS analysis)

    • Comparison with nuclear-encoded homologs in other species

    • Investigation of potential RNA editing sites in the transcript

For mitochondrial cytochrome proteins, a high interspecific amino acid conservation index (similar to the 97.7% observed for other cytochrome b residues) would be indicative of functional importance . This multifaceted bioinformatic approach would provide insights into AtMg00590's potential functions and guide experimental design for functional characterization.

What statistical approaches should be used to analyze phenotypic data from AtMg00590 mutants?

Analyzing phenotypic data from AtMg00590 mutants requires robust statistical approaches tailored to the specific experimental designs and data types commonly encountered in plant mitochondrial research:

  • Experimental design considerations:

    • Implement complete randomized designs with appropriate blocking

    • Include technical and biological replicates with clear distinction

    • Plan for repeated measures when assessing time-dependent phenotypes

    • Calculate required sample sizes based on power analysis

  • Normalization and transformation strategies:

    • Assess data distribution and apply appropriate transformations if needed

    • Consider relative measurements (e.g., percent of wild-type) for cross-experiment comparisons

    • Use internal standards for physiological measurements

    • Implement standardized growth stage-based phenotyping protocols

  • Statistical test selection:

    Data TypeRecommended TestConsiderations
    Continuous phenotypic dataANOVA with post-hoc tests (Tukey HSD)Check assumptions of normality and homoscedasticity
    Time-series measurementsRepeated measures ANOVA or mixed modelsAccount for time correlation structure
    Count dataGeneralized linear models (Poisson or negative binomial)Check for overdispersion
    Survival/duration dataCox proportional hazards or Kaplan-MeierConsider censoring in experimental design
  • Multiple testing correction:

    • Apply FDR correction (Benjamini-Hochberg) for genome-wide or high-dimensional data

    • Use Bonferroni correction for targeted hypothesis testing with few comparisons

    • Report both uncorrected and corrected p-values for transparency

  • Advanced analytical approaches:

    • Multivariate analysis (PCA, clustering) to identify patterns across multiple phenotypes

    • Machine learning for phenotype classification and prediction

    • Bayesian hierarchical modeling to integrate prior knowledge

    • Meta-analysis methods to combine results across experiments

For phenotypic data analysis, a standardized workflow starting with exploratory data analysis, followed by appropriate statistical testing and visualization, ensures robust interpretation of AtMg00590 mutant phenotypes across different experimental conditions and developmental stages .

How can researchers interpret contradictory data regarding AtMg00590 function in different experimental systems?

Contradictory results are common in biological research, especially when studying complex systems like mitochondrial proteins. Resolving such contradictions requires systematic approaches:

  • Systematic comparison framework:

    • Create a comprehensive table documenting all experimental variables

    • Identify key differences in:

      • Growth conditions (light, temperature, media composition)

      • Plant developmental stages and tissue types

      • Genetic backgrounds (ecotype differences, mutation types)

      • Experimental methodologies and measurement techniques

  • Biological context evaluation:

    • Consider condition-dependent protein functions

    • Analyze potential redundancy with related proteins

    • Evaluate compensatory mechanisms that may mask phenotypes

    • Assess interaction with environmental variables

  • Technical validation strategy:

    • Reproduce key experiments using standardized protocols

    • Implement independent methods to measure the same parameter

    • Blind analysis to minimize experimenter bias

    • Cross-validation in different laboratories

  • Integration through mechanistic modeling:

    • Develop conceptual models that can account for context-dependent functions

    • Implement computational simulations to test hypotheses

    • Design critical experiments to differentiate between competing models

    • Consider threshold effects and non-linear responses

  • Targeted resolution experiments:

    Contradiction TypeResolution ApproachExpected Outcome
    Growth condition-dependentSystematic condition gradient testingIdentification of transition points
    Developmental stage-specificFine-grained temporal analysisStage-specific function mapping
    Genetic background effectsIsogenic line comparisonsIsolation of mutation-specific effects
    Methodology-relatedSide-by-side technique comparisonDetermination of method biases

What are the most promising approaches for characterizing the role of AtMg00590 in mitochondrial-nuclear communication?

Mitochondrial-nuclear communication is essential for cellular homeostasis, and characterizing AtMg00590's role in this process requires multifaceted approaches:

  • Transcriptome-based strategies:

    • RNA-seq analysis comparing wild-type and AtMg00590 mutants under various conditions

    • Focus on nuclear genes known to respond to mitochondrial signals

    • Analysis of mitochondrial dysfunction stimulon (MDS) genes specifically

    • Time-course experiments to capture dynamic responses

  • Protein interaction network mapping:

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Proximity-dependent biotin identification (BioID) with mitochondrial targeting

    • Investigation of potential interactions with known retrograde signaling components

    • Analysis of interactions with nuclear factors like RCD1, which coordinates mitochondrial and chloroplast functions

  • Metabolite and ROS signaling assessment:

    • Targeted metabolomics focusing on known retrograde signaling molecules

    • ROS detection using specific probes and sensors

    • Inhibitor studies using antimycin A or myxothiazol to perturb electron transport

    • Analysis of mitochondrial membrane potential dynamics

  • Genetic interaction studies:

    • Creation of double mutants with known retrograde signaling components

    • Analysis of epistatic relationships with ANAC013/ANAC017 transcription factors

    • Investigation of genetic interactions with RCD1 and related proteins

    • CRISPR-based screens for modifiers of AtMg00590 phenotypes

  • Integrative multi-omics approaches:

    • Combination of transcriptomics, proteomics, and metabolomics data

    • Network analysis to identify key regulatory hubs

    • Machine learning to predict signaling relationships

    • Development of computational models for retrograde signaling pathways

The integration of these approaches would provide comprehensive insights into how AtMg00590 contributes to mitochondrial-nuclear communication, potentially revealing new mechanisms of retrograde signaling and organellar coordination in plant cells .

How might high-throughput functional genomics approaches be applied to study AtMg00590?

High-throughput functional genomics offers powerful approaches for characterizing AtMg00590 in the broader context of plant mitochondrial function:

  • CRISPR-based screening platforms:

    • Genome-wide screens for genetic interactions with AtMg00590

    • Targeted screens focusing on mitochondrial and chloroplast functions

    • Implementation of CRISPR activation/inhibition systems for gain/loss-of-function studies

    • Development of base editing approaches for precise sequence modifications

  • Systematic phenotypic analysis:

    • Implementation of standardized growth stage-based phenotyping

    • Automated image-based phenotyping using machine learning algorithms

    • High-throughput physiological measurements (photosynthesis, respiration)

    • Developmental stage-specific phenotyping to capture temporal dynamics

  • Multi-omics integration approaches:

    • Coordinated analysis of transcriptome, proteome, and metabolome data

    • Spatial transcriptomics to capture tissue-specific responses

    • Single-cell approaches to identify cell-type specific functions

    • Epitranscriptomics to characterize m6A methylation and other RNA modifications

  • Comparative functional genomics:

    • Analysis across multiple plant species with varying environmental adaptations

    • Evolutionary comparative approaches to identify conserved functions

    • Ortholog complementation studies to test functional conservation

    • High-throughput interspecies genetic interaction mapping

  • Data integration and modeling:

    Data TypeIntegration ApproachExpected Insights
    PhenomicsMachine learning classificationFunctional clustering of mutants
    TranscriptomicsGene regulatory network inferenceIdentification of key transcription factors
    ProteomicsProtein-protein interaction networksDiscovery of functional complexes
    MetabolomicsPathway flux analysisMetabolic consequences of AtMg00590 perturbation

High-throughput approaches enable systematic characterization of gene function, providing a comprehensive understanding of AtMg00590's role in plant mitochondrial function and its broader implications for cellular energy metabolism and stress responses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.