Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00140 (AtMg00140)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AtMg00140; Uncharacterized mitochondrial protein AtMg00140; ORF167
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
AtMg00140
Target Protein Sequence
MNQLDQYSQPMQHLILLWFWLLDLSPPPSFHLSVKSVDLSLFSLSPLFLLLSISSLIFSR VNKFGIRRVGYAMAPKPDPTVLPDLQEKKAILGTQIEMITQAMTTLESRVTDLQQESNDH RTWVREALDKLLKRDLGDENRPKPTTNKMIATGEQHKGEVSTSLFHD
Uniprot No.

Target Background

Database Links
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

How can researchers obtain recombinant AtMg00140 for experimental studies?

Recombinant AtMg00140 can be expressed in heterologous systems, most commonly in E. coli expression systems. The full-length protein (amino acids 1-167) can be produced with an N-terminal His-tag to facilitate purification . The expression construct should contain the complete coding sequence optimized for the chosen expression system. For optimal expression:

  • Consider codon optimization for E. coli if expression yields are low

  • Use strain BL21(DE3) or derivatives for reduced proteolytic degradation

  • Induce expression at lower temperatures (16-20°C) to enhance proper folding

  • Purify using immobilized metal affinity chromatography (IMAC)

  • Store purified protein in Tris/PBS-based buffer with 6% trehalose at pH 8.0

When working with this uncharacterized protein, researchers should validate the quality of the recombinant product through SDS-PAGE and western blotting before proceeding with functional studies.

What are the recommended storage conditions for recombinant AtMg00140?

For optimal stability and activity retention of recombinant AtMg00140, researchers should follow these storage guidelines:

Storage ParameterRecommendation
Short-term storage4°C for up to one week
Long-term storage-20°C or -80°C
Buffer compositionTris/PBS-based buffer with 6% trehalose, pH 8.0
AliquotingEssential to avoid repeated freeze-thaw cycles
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Glycerol addition5-50% final concentration (50% recommended)

Repeated freeze-thaw cycles should be strictly avoided as they may lead to protein denaturation and loss of structural integrity . Following reconstitution from lyophilized form, the protein should be aliquoted immediately to prevent quality degradation during subsequent experimental use.

What expression systems are optimal for studying AtMg00140 function?

When designing experiments to study AtMg00140 function, researchers should consider multiple expression systems based on specific research questions:

For functional studies, researchers should consider the limitations of heterologous expression systems, particularly regarding protein folding, post-translational modifications, and subcellular targeting. When designing vectors for plant expression systems, appropriate mitochondrial targeting sequences must be maintained or engineered to ensure proper localization.

What experimental approaches are recommended for determining AtMg00140 subcellular localization?

Confirming the mitochondrial localization of AtMg00140 requires multiple complementary techniques:

  • Fluorescent protein fusion analysis:

    • Create C-terminal and N-terminal GFP fusions with AtMg00140

    • Transform into Arabidopsis protoplasts or stable transgenic lines

    • Co-localize with established mitochondrial markers (e.g., MitoTracker)

    • Image using confocal microscopy

  • Subcellular fractionation and western blotting:

    • Isolate intact mitochondria from Arabidopsis tissues

    • Perform subfractionation to separate mitochondrial membranes from matrix

    • Detect AtMg00140 using specific antibodies in each fraction

    • Include controls for each mitochondrial compartment (outer membrane, inner membrane, intermembrane space, matrix)

  • Immunogold electron microscopy:

    • Fix and section plant tissue samples

    • Label with AtMg00140-specific antibodies and gold-conjugated secondary antibodies

    • Visualize precise submitochondrial localization at ultrastructural level

These approaches should be implemented in parallel, as each provides complementary information about protein localization. Comparing native AtMg00140 localization with that of recombinant tagged versions is essential to validate that tagging does not disrupt normal targeting.

How should researchers design knockout or knockdown experiments for AtMg00140?

When designing gene modification experiments for AtMg00140, researchers must consider its mitochondrial genome location, which presents unique challenges compared to nuclear genes:

  • CRISPR-Cas9 approach for mitochondrial genes:

    • Traditional CRISPR systems face barriers in targeting mitochondrial DNA

    • Consider using mitochondrially-targeted nucleases with customized delivery systems

    • Design guide RNAs specific to AtMg00140 sequence with minimal off-target potential

    • Validate editing efficiency using PCR and sequencing as demonstrated in similar Arabidopsis studies

  • RNA interference strategy:

    • Design constructs targeting AtMg00140 transcript

    • Use mitochondrially-targeted RNAi constructs

    • Confirm knockdown efficiency via qRT-PCR and western blotting

    • Monitor phenotypic effects at cellular and whole-plant levels

  • Antisense approaches:

    • Create antisense constructs complementary to AtMg00140 mRNA

    • Express using strong promoters in stable transformants

    • Validate expression reduction through molecular techniques

For all approaches, researchers should include appropriate controls and consider potential compensatory mechanisms that may mask phenotypes. Additionally, monitoring plant development throughout all growth stages is crucial, as mitochondrial protein deficiencies may manifest differently depending on developmental stage and tissue type.

What are the predicted protein-protein interaction partners of AtMg00140 and how can they be experimentally validated?

Identifying interaction partners is crucial for understanding the function of uncharacterized proteins like AtMg00140. Potential approaches include:

  • Computational prediction:

    • Employ interactome databases for Arabidopsis mitochondrial proteins

    • Use structure-based prediction tools if structural data becomes available

    • Apply co-expression analysis to identify functionally related genes

  • Experimental validation approaches:

    • Yeast two-hybrid screening: Use AtMg00140 as bait against Arabidopsis cDNA libraries

    • Co-immunoprecipitation: Generate antibodies against AtMg00140 or use tagged versions to pull down interaction partners

    • Proximity labeling: Apply BioID or APEX2 fusion strategies to identify proximal proteins in the native mitochondrial environment

    • Crosslinking mass spectrometry: Capture transient interactions through chemical crosslinking followed by MS analysis

  • Validation strategy:

    • Confirm interactions through reciprocal co-IP experiments

    • Perform subcellular co-localization studies

    • Assess functional relevance through co-expression analysis

    • Conduct genetic interaction studies with putative partners

When designing two-way co-immunoprecipitation experiments, researchers should follow protocols similar to those used in Case Study 2 from search result , adapting the methodology for mitochondrial proteins. Consider membrane solubilization conditions carefully if AtMg00140 is membrane-associated.

What approaches should be used to investigate the evolutionary conservation of AtMg00140 across plant species?

Understanding the evolutionary history of AtMg00140 can provide insights into its functional importance:

  • Comparative genomics approach:

    • Identify orthologs in other plant species through BLAST searches

    • Align sequences to identify conserved domains and motifs

    • Construct phylogenetic trees to visualize evolutionary relationships

    • Analyze selection pressure (dN/dS ratios) across identified sequences

  • Structural conservation analysis:

    • Predict secondary structures of orthologs

    • Compare hydrophobicity profiles across species

    • Identify conserved post-translational modification sites

    • Apply homology modeling if structural templates become available

  • Functional complementation experiments:

    • Express AtMg00140 orthologs from different species in Arabidopsis

    • Assess ability to rescue AtMg00140 knockout/knockdown phenotypes

    • Analyze domain swapping between orthologs to identify functional regions

When presenting evolutionary data, researchers should create comprehensive tables showing percent identity/similarity between AtMg00140 and its orthologs across plant lineages, along with corresponding mitochondrial targeting prediction scores, to help contextualize sequence conservation within functional constraints.

How can researchers investigate post-translational modifications of AtMg00140?

Post-translational modifications (PTMs) often regulate protein function, particularly in mitochondrial proteins. For AtMg00140, consider these approaches:

  • Computational prediction:

    • Analyze the sequence for potential phosphorylation, acetylation, or other modification sites

    • Compare predicted sites across orthologs to identify conserved modification regions

    • Use specialized PTM prediction tools for mitochondrial proteins

  • Mass spectrometry-based identification:

    • Isolate AtMg00140 from plant mitochondria under various conditions

    • Perform targeted MS/MS analysis for specific modifications

    • Consider enrichment strategies for phosphopeptides or other modified residues

    • Compare PTM profiles under different stress conditions or developmental stages

  • Functional validation:

    • Generate site-specific mutants (e.g., phosphomimetic or non-phosphorylatable)

    • Express mutants in plant systems and assess functional consequences

    • Develop modification-specific antibodies for detailed PTM dynamics studies

When designing mass spectrometry experiments, researchers should consider both bottom-up (digested peptides) and top-down (intact protein) approaches to comprehensively map modifications across the entire protein sequence.

What are the challenges in producing high-quality antibodies against AtMg00140?

Developing specific antibodies against AtMg00140 presents several challenges:

  • Antigen design considerations:

    • Select unique, accessible regions of AtMg00140 based on predicted structure

    • Avoid highly hydrophobic segments that may challenge antibody recognition

    • Consider both full-length protein and synthetic peptide approaches

    • Ensure selected epitopes have minimal similarity to other Arabidopsis proteins

  • Production strategy options:

    • Recombinant protein approach: Express full-length AtMg00140 with tags

    • Synthetic peptide approach: Design peptides from unique regions

    • Genetic immunization: Use DNA constructs encoding AtMg00140

  • Validation requirements:

    • Test against recombinant protein and native extracts

    • Perform preabsorption controls with immunizing antigen

    • Validate in knockout/knockdown lines as negative controls

    • Check cross-reactivity with related proteins

In antibody production planning, researchers should prioritize epitopes that are conserved across ecotypes but unique to AtMg00140, while considering potential post-translational modifications that might affect antibody recognition in the native protein context.

How should researchers optimize extraction and solubilization of membrane-associated mitochondrial proteins like AtMg00140?

If AtMg00140 is indeed membrane-associated, its extraction requires specific considerations:

  • Mitochondrial isolation optimization:

    • Use density gradient centrifugation for high-purity mitochondria

    • Preserve intact organelles through gentle homogenization

    • Validate mitochondrial fraction purity with marker proteins

    • Consider developmental stage and tissue source for optimal yields

  • Solubilization strategy development:

    • Test multiple detergents (digitonin, DDM, CHAPS) at various concentrations

    • Optimize buffer composition (pH, salt concentration, stabilizing agents)

    • Consider native extraction conditions for maintaining protein interactions

    • Include protease inhibitors and phosphatase inhibitors

  • Extraction efficiency assessment:

    • Compare different extraction methods via western blotting

    • Measure protein activity if functional assays are available

    • Assess extraction reproducibility across biological replicates

    • Monitor protein stability in different extraction buffers over time

DetergentRecommended ConcentrationBest For
Digitonin0.5-1%Gentle solubilization, maintaining complex integrity
DDM0.5-2%Efficient solubilization of membrane proteins
CHAPS0.5-1%Solubilization while maintaining enzymatic activity
Triton X-1000.1-1%Stronger solubilization for resistant membrane proteins

Researchers should conduct pilot experiments comparing these detergents to determine the optimal conditions for AtMg00140 extraction while maintaining its native conformation and potential interaction partners.

What control proteins should be included when studying AtMg00140 expression patterns?

When analyzing AtMg00140 expression, appropriate controls are essential:

  • Mitochondrial genome-encoded controls:

    • Include other mitochondrial-encoded proteins with known expression patterns

    • Select proteins from different functional categories (respiratory components, ribosomal proteins)

    • Compare with nuclear-encoded mitochondrial proteins to detect organelle-specific regulation

  • Tissue-specific reference genes:

    • Use stable reference genes appropriate for each tissue type being studied

    • Validate reference stability under experimental conditions

    • Consider multiple references for normalization

  • Stress response controls:

    • Include known stress-responsive mitochondrial genes

    • Compare with nuclear stress markers

    • Monitor mitochondrial housekeeping genes for baseline stability

For qRT-PCR experiments, researchers should validate primer efficiency using standard curves and include no-template and no-reverse-transcriptase controls. Expression data should be normalized using multiple reference genes validated for stability under the specific experimental conditions being studied.

How should researchers interpret potential phenotypes associated with AtMg00140 disruption?

When analyzing phenotypes from AtMg00140 modification experiments, consider these approaches:

  • Comprehensive phenotypic screening:

    • Examine both macroscopic (growth, development) and microscopic (cellular, subcellular) phenotypes

    • Assess mitochondrial function using respiration measurements, membrane potential, and ROS production

    • Analyze metabolic profiles, particularly mitochondrial metabolites

    • Evaluate stress responses and adaptive phenotypes

  • Distinguishing primary from secondary effects:

    • Conduct time-course experiments to determine sequence of phenotypic changes

    • Use inducible systems to monitor immediate consequences of AtMg00140 disruption

    • Perform targeted metabolomics to identify metabolic pathways directly affected

    • Compare with phenotypes of known mitochondrial mutants for pattern recognition

  • Environmental and developmental contexts:

    • Test phenotypes under multiple growth conditions (light, temperature, nutrients)

    • Analyze throughout development from germination to senescence

    • Consider tissue-specific effects through microscopy and tissue-specific markers

    • Evaluate reproductive development and seed production carefully

Researchers should pay particular attention to subtle phenotypes that might not be immediately obvious, such as alterations in mitochondrial morphology, changes in stress tolerance, or modifications to metabolic profiles under specific conditions.

What approaches can be used to determine the membrane topology of AtMg00140?

If AtMg00140 is membrane-associated, determining its topology is critical for functional understanding:

  • Computational prediction approaches:

    • Apply multiple transmembrane prediction algorithms (TMHMM, Phobius, CCTOP)

    • Analyze hydrophobicity plots and amphipathic regions

    • Identify potential membrane-interacting motifs

    • Create consensus topology models from multiple predictions

  • Experimental validation methods:

    • Protease protection assays: Treat isolated mitochondria with proteases before and after membrane disruption

    • Epitope tagging accessibility: Insert tags at various positions and assess accessibility

    • TOXCAT/GALLEX assays: Adapt these bacterial systems for studying transmembrane interactions

    • Cysteine scanning mutagenesis: Introduce cysteines and test accessibility to membrane-impermeable reagents

  • Advanced structural approaches:

    • Cryo-electron microscopy if the protein forms part of a larger complex

    • NMR studies of specific domains in membrane mimetics

    • Crosslinking combined with mass spectrometry to identify spatial relationships

The experimental approach should begin with computational predictions to guide experimental design, followed by biochemical approaches to test the proposed topology model. Results should be integrated to generate a comprehensive topology map to guide functional studies.

How can researchers address the challenges of functional redundancy when studying AtMg00140?

Functional redundancy can complicate phenotypic analysis of AtMg00140:

  • Identification of potential redundant proteins:

    • Search for sequence or structural homologs in the Arabidopsis genome

    • Analyze co-expression patterns to identify functionally related genes

    • Examine proteins with similar predicted localization and structure

    • Consider dual-targeted proteins (nucleus/mitochondria or chloroplast/mitochondria)

  • Experimental strategies for redundancy assessment:

    • Generate multiple gene knockouts/knockdowns

    • Create overexpression lines of AtMg00140 to potentially overcome redundancy

    • Perform synthetic lethality screens to identify genetic interactions

    • Use tissue-specific or inducible systems to bypass developmental lethality

  • Biochemical approaches:

    • Conduct activity assays with purified components to test functional overlap

    • Analyze protein-protein interaction networks for common partners

    • Perform complementation assays with related proteins

    • Use dominant negative constructs to potentially affect redundant proteins

When studying uncharacterized proteins like AtMg00140, researchers should design experiments that can detect subtle phenotypes and consider combinatorial approaches that may reveal functions masked by redundancy in single gene studies.

How can proteomics approaches be utilized to understand AtMg00140 function in the context of the mitochondrial proteome?

Advanced proteomics offers powerful tools for functional characterization:

  • Quantitative proteomics approaches:

    • Compare mitochondrial proteome profiles between wild-type and AtMg00140 knockout/knockdown plants

    • Use SILAC, TMT, or label-free quantification for accurate comparisons

    • Apply targeted proteomics (PRM/SRM) for focused analysis of affected pathways

    • Analyze protein abundance changes under different stress conditions

  • Protein complex analysis:

    • Employ Blue Native PAGE coupled with mass spectrometry

    • Apply complexome profiling to position AtMg00140 within mitochondrial protein complexes

    • Use chemical crosslinking mass spectrometry to map protein interaction networks

    • Perform co-immunoprecipitation with quantitative MS readout

  • Advanced spatial proteomics:

    • Apply proximity labeling approaches (BioID, APEX) with AtMg00140 as bait

    • Use hyperLOPIT for suborganellar localization mapping

    • Consider in situ structural approaches like APEX-MS

When designing proteomics experiments, researchers should plan appropriate biological replicates, include controls for mitochondrial purity, and consider multiple physiological conditions to capture dynamic changes in the mitochondrial proteome associated with AtMg00140 function.

What are the best approaches for integrating transcriptomic and metabolomic data in AtMg00140 functional studies?

Multi-omics integration provides comprehensive insights into protein function:

  • Experimental design considerations:

    • Collect samples for different omics from the same biological material

    • Include appropriate time points to capture primary and secondary effects

    • Consider multiple tissues and developmental stages

    • Design stress treatments relevant to mitochondrial function

  • Integration strategies:

    • Apply pathway-based integration using knowledge databases

    • Use correlation networks to identify functional relationships

    • Employ multivariate statistical methods (PCA, OPLS-DA)

    • Consider Bayesian integration frameworks for causal relationship inference

  • Validation approaches:

    • Test computational predictions with targeted experiments

    • Use metabolic flux analysis to confirm metabolic alterations

    • Perform targeted gene expression studies for key pathways

    • Consider genetic complementation to validate key nodes

The integration of transcriptomic and metabolomic data requires sophisticated bioinformatic approaches. Researchers should collaborate with computational biologists to develop appropriate data integration pipelines tailored to mitochondrial biology questions.

How can structural biology approaches be applied to an uncharacterized protein like AtMg00140?

Structural characterization provides essential functional insights:

  • Computational structure prediction:

    • Apply AlphaFold2 or RoseTTAFold for initial structural models

    • Validate predictions through evolutionary conservation analysis

    • Identify potential functional domains or motifs

    • Use molecular dynamics simulations to predict stability and flexibility

  • Experimental structure determination strategies:

    • Express and purify domains amenable to structural studies

    • Consider NMR for smaller soluble domains

    • Apply X-ray crystallography if crystallization is successful

    • Use cryo-EM for larger complexes containing AtMg00140

  • Functional validation of structural insights:

    • Design site-directed mutagenesis based on structural predictions

    • Test effects of mutations on protein stability and activity

    • Probe predicted interaction interfaces

    • Analyze evolutionary conservation in the context of structural features

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.