Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00150 (AtMg00150)

Shipped with Ice Packs
In Stock

Description

Physical and Biochemical Properties

The recombinant form of AtMg00150 is produced with an N-terminal His-tag, which facilitates purification while potentially providing minimal interference with the protein's native structure and function . The physical and biochemical properties of AtMg00150 are summarized in Table 1.

Table 1: Physical and Biochemical Properties of Recombinant AtMg00150

PropertyCharacteristic
Protein LengthFull Length (1-116 amino acids)
SourceE. coli expression system
TagN-terminal His-tag
FormLyophilized powder
Purity>90% (determined by SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ApplicationsSDS-PAGE

This information is crucial for researchers planning to use the recombinant protein in experimental studies, as it provides guidance on handling and application parameters .

Production and Purification of Recombinant AtMg00150

The recombinant production of AtMg00150 involves expression in bacterial systems followed by purification steps that yield high-purity protein suitable for research applications.

Expression System

Recombinant AtMg00150 is expressed in Escherichia coli, which represents a standard and efficient prokaryotic system for producing plant proteins that do not require extensive post-translational modifications . The use of E. coli allows for high-yield production of the target protein under controlled conditions.

Purification and Quality Control

The recombinant protein is purified to greater than 90% purity as determined by SDS-PAGE analysis . The N-terminal His-tag enables efficient purification using affinity chromatography, a standard method for isolating recombinant proteins. This high level of purity makes the commercial product suitable for various biochemical and functional studies.

Potential Biological Functions in Plant Mitochondria

While the specific function of AtMg00150 remains unknown, examining the roles of other characterized mitochondrial proteins in Arabidopsis thaliana provides context for hypothesizing potential functions.

Context of Plant Mitochondrial Proteins

Plant mitochondria contain diverse proteins involved in essential cellular processes, including respiratory chain components, metabolic enzymes, and proteins facilitating the import and processing of other molecules. Understanding this broader context is crucial for developing hypotheses about the potential roles of uncharacterized proteins like AtMg00150.

Comparative Analysis with Other Mitochondrial Proteins

Other uncharacterized mitochondrial proteins in Arabidopsis thaliana, such as AtMg00880, share similar characteristics with AtMg00150 in being encoded by the mitochondrial genome and having unknown functions . While AtMg00880 is larger (187 amino acids) compared to AtMg00150 (116 amino acids), comparative analysis between these proteins might provide insights into potential functional relationships.

Research on characterized mitochondrial proteins like Tric1 and Tric2, which are involved in tRNA import into mitochondria, has shown that these proteins contain specific domains such as the SAM (sterile-α-motif) domain that enables RNA binding . Although AtMg00150 lacks identified domains based on available information, understanding the functional domains in characterized proteins provides a framework for investigating potential domains in AtMg00150.

Research Applications and Experimental Approaches

The availability of recombinant AtMg00150 enables various research approaches to characterize its properties and functions.

Current Research Applications

The recombinant AtMg00150 protein is primarily used for SDS-PAGE applications, as indicated in product specifications . This suggests its utility in protein analysis techniques and potentially in generating antibodies for immunological detection methods. The availability of the recombinant protein facilitates biochemical assays to investigate its potential functions and interactions.

Recommended Experimental Approaches

Several experimental approaches could be employed to elucidate the biological function of AtMg00150:

Table 3: Potential Experimental Approaches for Characterizing AtMg00150

ApproachMethodologyExpected Outcome
Protein-Protein Interaction StudiesCo-immunoprecipitation, Yeast two-hybrid, Protein crosslinkingIdentification of binding partners and potential functional complexes
Subcellular LocalizationImmunofluorescence microscopy, FractionationConfirmation of mitochondrial localization and sub-organellar distribution
Gene Expression AnalysisRT-PCR, RNA-Seq, Promoter-reporter assaysTissue-specific and condition-dependent expression patterns
Loss-of-Function StudiesCRISPR/Cas9, RNAi, T-DNA insertion linesPhenotypic effects of AtMg00150 deficiency
Structural AnalysisX-ray crystallography, NMR, Cryo-EMThree-dimensional structure and potential functional domains

These approaches, similar to those used for characterizing other plant proteins such as the AtMLO family , would provide complementary data to develop a comprehensive understanding of AtMg00150's function.

Integration with Existing Mitochondrial Research

Research on plant mitochondrial gene expression and protein function has revealed complex regulatory mechanisms. For instance, studies of tric1tric2 mutant plants demonstrated altered mitochondrial protein content and significant changes in the transcription of mitochondrial genes . Similar approaches could be applied to investigate potential roles of AtMg00150 in mitochondrial processes.

The comprehensive expression analysis performed for the AtMLO gene family demonstrated that each gene has a unique expression pattern and responds differently to various biotic and abiotic stimuli . Similar analyses for AtMg00150 could provide valuable information about its regulation and potential functional contexts.

Future Research Directions

The characterization of AtMg00150 represents an important step in filling knowledge gaps in plant mitochondrial biology. Several promising research directions could advance our understanding of this protein.

Functional Genomics Approaches

Employing functional genomics approaches such as CRISPR/Cas9-mediated gene editing or RNA interference (RNAi) to generate loss-of-function mutants would enable researchers to observe phenotypic effects associated with AtMg00150 deficiency. These approaches have been successfully used to characterize other plant mitochondrial proteins, such as Tric1 and Tric2 .

Interactome Analysis

Comprehensive mapping of protein-protein interactions involving AtMg00150 would provide insights into its potential functional networks. Techniques such as proximity-dependent biotin identification (BioID) or affinity purification coupled with mass spectrometry could identify proteins that interact with AtMg00150, potentially revealing its role in specific mitochondrial processes.

Evolutionary Analysis

Comparative genomic analysis of AtMg00150 homologs across plant species could reveal evolutionary conservation patterns, providing clues about its functional importance. Identifying conserved regions within the protein sequence might highlight functionally critical domains that have been maintained throughout evolutionary history.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
AtMg00150; Uncharacterized mitochondrial protein AtMg00150; ORF116
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
AtMg00150
Target Protein Sequence
MSRSSIGPELEVNSKPLKGPIICPIRTYYSKVPLELLFPTTDRRFYFLKSYVFCSANSVP LYLLLLTSALHFNSYILLFDFQLKSKLLAYKRRARCVAGLLKSMERYPESTVTAMI
Uniprot No.

Target Background

Database Links
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is AtMg00150 and where is it encoded in the Arabidopsis thaliana genome?

AtMg00150 is an uncharacterized mitochondrial protein encoded by the mitochondrial genome (indicated by the "AtMg" prefix) in Arabidopsis thaliana. It is one of several mitochondrially-encoded proteins that play potential roles in organelle function and intercellular communication. The protein is encoded within the mitochondrial DNA rather than the nuclear genome, which is significant for understanding its regulation, expression, and evolutionary history . Mitochondrially-encoded proteins like AtMg00150 are typically involved in electron transport chains, ATP synthesis, or other fundamental mitochondrial processes, although the specific function of this particular protein remains uncharacterized.

How can researchers obtain recombinant AtMg00150 protein for experimental studies?

Researchers can obtain recombinant AtMg00150 protein through several approaches. Commercial sources like CUSABIO TECHNOLOGY LLC offer ready-made recombinant protein preparations . Alternatively, researchers can produce the protein themselves using standard recombinant protein expression systems. The process typically involves:

  • Amplifying the AtMg00150 gene from Arabidopsis mitochondrial DNA

  • Cloning it into an appropriate expression vector (typically with a tag for purification)

  • Transforming the construct into a suitable expression system (bacterial, yeast, insect, or mammalian)

  • Inducing protein expression under optimized conditions

  • Purifying the recombinant protein using affinity chromatography based on the fusion tag

When selecting an expression system, consider that mitochondrial proteins may require specific post-translational modifications or chaperones for proper folding. Expression in eukaryotic systems might yield more functionally relevant protein conformations than bacterial systems.

What expression patterns does AtMg00150 exhibit during plant development?

The expression patterns of AtMg00150 can be analyzed through various stages of plant development. Research indicates that mitochondrial gene expression, including that of AtMg00150, shows dynamic patterns during embryogenesis and other developmental stages. Specifically, in the increased size exclusion limit (ise) mutants, which affect intercellular transport via plasmodesmata, several mitochondrial genes show altered expression patterns .

The expression of AtMg00150 appears to be regulated in response to developmental cues and potentially environmental stresses. While specific expression data for AtMg00150 is limited in the provided search results, the mitochondrial proteome studies suggest that proteins like AtMg00150 may be involved in cellular responses to various environmental conditions including salt, drought, cold, and wound stresses .

What is the relationship between AtMg00150 expression and plasmodesmata function in Arabidopsis?

The relationship between mitochondrial proteins like AtMg00150 and plasmodesmata (PD) function represents a fascinating area of plant cell biology research. Evidence from studies on mutants with altered PD transport capabilities suggests a significant cross-talk between mitochondria, plastids, and PD development/function.

Research on increased size exclusion limit (ise) mutants has revealed that disruption of organelle function, particularly mitochondria and plastids, affects PD morphology and transport capacity. While AtMg00150 is not specifically mentioned in relation to PD function, the broader context of organelle-nucleus-plasmodesmata signaling suggests that mitochondrial proteins contribute to this communication network .

When investigating the relationship between AtMg00150 and PD function, researchers should consider:

  • Analyzing AtMg00150 expression in ise1 and ise2 mutants

  • Performing virus-induced gene silencing of AtMg00150 and assessing effects on PD transport

  • Using fluorescent tracers to evaluate cell-to-cell movement in plants with altered AtMg00150 expression

  • Examining PD ultrastructure using transmission electron microscopy in plants with modified AtMg00150 levels

These approaches will help determine whether AtMg00150 participates in the organelle-nucleus-plasmodesmata signaling pathway that regulates intercellular communication.

How does AtMg00150 function within the broader mitochondrial proteome of Arabidopsis?

Understanding the function of AtMg00150 within the broader mitochondrial proteome requires consideration of protein interaction networks, co-expression patterns, and evolutionary conservation. Current computational frameworks for predicting mitochondrial proteins in Arabidopsis have identified approximately 2,585 mitochondrial proteins (CoreMitoP) .

To investigate AtMg00150's function within this network:

  • Analyze protein-protein interaction networks to identify potential binding partners

  • Examine co-expression patterns across diverse conditions using the 1,027 microarray profiles available for Arabidopsis

  • Compare orthologous proteins in other species to identify conserved domains or functions

  • Conduct domain analysis to predict potential biochemical activities

Research indicates that approximately 26.65% of CoreMitoP proteins have unknown functions, suggesting that AtMg00150 is among a substantial group of mitochondrial proteins awaiting functional characterization . Network-based approaches have successfully assigned functions to many previously uncharacterized mitochondrial proteins and could be applied to AtMg00150.

What experimental approaches are most effective for characterizing the function of uncharacterized mitochondrial proteins like AtMg00150?

Characterizing uncharacterized mitochondrial proteins like AtMg00150 requires a multi-faceted approach combining genomic, proteomic, and cellular techniques:

  • Reverse Genetics Approaches:

    • CRISPR/Cas9 genome editing to create knockout or knockdown lines

    • Analysis of T-DNA insertion mutants if available

    • RNA interference or virus-induced gene silencing to reduce expression

  • Protein Localization and Interaction Studies:

    • GFP fusion protein expression to confirm mitochondrial localization

    • Co-immunoprecipitation to identify protein interaction partners

    • Yeast two-hybrid screening for protein-protein interactions

    • BioID or proximity labeling to identify proteins in close proximity

  • Functional Assays:

    • Phenotypic analysis of mutants under various growth conditions

    • Measurement of mitochondrial function parameters (respiration, membrane potential)

    • Metabolomic profiling to identify affected metabolic pathways

  • Expression Analysis:

    • RNA-seq to determine transcriptional responses to AtMg00150 alteration

    • Quantitative RT-PCR to validate expression changes

    • Proteomics to assess impact on the broader mitochondrial proteome

These approaches should be complemented by computational analyses leveraging existing datasets, as demonstrated by the Naive Bayesian Network approach that has successfully predicted mitochondrial proteins with 84.67% accuracy .

What protocols are recommended for isolating and purifying mitochondria from Arabidopsis tissues for AtMg00150 studies?

Isolating pure, intact mitochondria is critical for studying mitochondrial proteins like AtMg00150. The following protocol synthesizes approaches from recent literature:

Differential Centrifugation and Density Gradient Purification Protocol:

  • Tissue Preparation:

    • Harvest 20-50g of fresh Arabidopsis tissue (leaves, seedlings, or embryos)

    • Homogenize in grinding buffer (0.3M sucrose, 25mM MOPS pH 7.5, 0.2% BSA, 0.6% PVP-40, 2mM EGTA, 4mM cysteine, 1mM PMSF)

  • Differential Centrifugation:

    • Filter homogenate through miracloth

    • Centrifuge at 3,000g for 5 minutes to remove debris

    • Centrifuge supernatant at 12,000g for 15 minutes to pellet mitochondria

    • Resuspend pellet in wash buffer (0.3M sucrose, 10mM MOPS pH 7.5, 0.1% BSA)

  • Percoll Gradient Purification:

    • Layer resuspended mitochondria on a three-step Percoll gradient (18%, 23%, 40%)

    • Centrifuge at 12,000g for 45 minutes

    • Collect mitochondria from the 23%/40% interface

    • Wash twice in final wash buffer (0.3M sucrose, 10mM MOPS pH 7.5)

  • Quality Assessment:

    • Measure cytochrome c oxidase activity

    • Assess contamination using markers for other organelles

    • Evaluate mitochondrial integrity using JC-1 staining

For embryo samples specifically, which may be relevant for developmental studies of AtMg00150, a modification of this protocol can be used as described in the literature. Approximately 100 seeds at the midtorpedo stage can be collected and processed using RNA Later before extraction .

How can researchers effectively use GFP fusion techniques to study AtMg00150 localization?

GFP fusion techniques provide powerful tools for confirming subcellular localization and studying dynamic behaviors of proteins like AtMg00150. Based on methods described in the literature, the following approach is recommended:

AtMg00150-GFP Fusion Protocol:

  • Construct Generation:

    • Amplify the full-length AtMg00150 coding sequence without the stop codon

    • Clone into a plant expression vector with C-terminal GFP fusion (e.g., pGWB5)

    • Confirm sequence integrity by DNA sequencing

  • Transient Expression:

    • Transform Agrobacterium tumefaciens with the AtMg00150-GFP construct

    • Infiltrate Nicotiana benthamiana leaves with the transformed Agrobacterium

    • Images can be collected 48 hours post-infiltration using confocal microscopy

  • Stable Transformation:

    • Transform Arabidopsis using floral dip method

    • Select transformants on appropriate selection media

    • Confirm expression using RT-PCR and fluorescence microscopy

  • Co-localization Studies:

    • Use MitoTracker dyes for co-localization with mitochondria

    • Include controls with known mitochondrial proteins

    • Apply quantitative co-localization analysis using software like ImageJ with JACoP plugin

  • Advanced Imaging:

    • Perform FRAP (Fluorescence Recovery After Photobleaching) to assess protein mobility

    • Use time-lapse imaging to observe dynamic behavior

    • Apply super-resolution microscopy for detailed localization

This approach has been successfully used for studying other mitochondrial proteins, and the same principles apply to AtMg00150 .

How should researchers interpret expression data for AtMg00150 in the context of organelle-nucleus cross-talk?

Interpreting expression data for AtMg00150 requires consideration of the broader context of organelle-nucleus cross-talk. The following framework is recommended:

  • Contextual Analysis:

    • Compare AtMg00150 expression changes with other mitochondrial genes

    • Assess correlation with changes in nuclear genes encoding mitochondrial proteins

    • Evaluate expression patterns in relation to plastid-related genes

  • Pathway Integration:

    • Map expression changes onto known mitochondrial functional pathways

    • Identify regulatory networks potentially involving AtMg00150

    • Consider the organelle-nucleus-plasmodesmata signaling pathway described in the literature

  • Mutant Comparison:

    • Analyze AtMg00150 expression in ise1 and ise2 mutants

    • The data in Table 3 from the literature shows several mitochondrial genes with altered expression in these mutants, providing context for AtMg00150

LocusGene nameise1 fold changeise2 fold change
AtMg00180CYTOCHROME C BIOGENESIS 452-+2.1
AtMg00665NADH DEHYDROGENASE 5B-+2.5
AtMg01030ORF106E-+2.0
AtMg01060ORF107G-+2.0
AtMg00530ORF109-+2.8
AtMg01020ORF153B-+3.4
AtMg01050ORF159-+2.4
AtMg00610ORF161-+4.3
AtMg00880ORF187-+6.7
AtMg01110ORF251-+2.7
AtMg01090ORF262-+5.0
AtMg00670ORF275+2.4+2.3
AtMg00160CYTOCHROME C OXIDASE SUBUNIT 2-+2.0
AtMg00730CYTOCHROME C OXIDASE SUBUNIT 3-+2.1
  • Stress Response Correlation:

    • Evaluate AtMg00150 expression under various stresses (salt, drought, cold, wounding)

    • Mitochondrial proteins are often involved in stress responses, and the research indicates specific subnetworks responding to environmental stresses

When interpreting expression data, researchers should use multiple normalization methods and validation through qRT-PCR as demonstrated in the literature for similar studies .

What bioinformatic approaches are most effective for predicting the function of AtMg00150?

Predicting the function of uncharacterized proteins like AtMg00150 requires integrative bioinformatic approaches. Based on successful methodologies described in the literature, the following strategies are recommended:

  • Naive Bayesian Network Integration:

    • Leverage the probabilistic model approach that has shown 84.67% accuracy in predicting mitochondrial proteins

    • Integrate data from multiple bioinformatics tools, orthologous mappings, protein domain properties, and co-expression patterns

    • This approach successfully identified 2,311 candidate mitochondrial proteins in previous studies

  • Protein-Protein Interaction Network Analysis:

    • Map AtMg00150 onto existing protein interaction networks

    • Identify subnetworks containing AtMg00150

    • Apply "guilt by association" principles to predict function based on interaction partners

    • This approach has successfully annotated functions for 26.65% of previously uncharacterized mitochondrial proteins

  • Comparative Genomics:

    • Identify orthologs in other plant species

    • Compare sequence conservation patterns to identify functional domains

    • Analyze synteny to understand evolutionary context

  • Domain and Motif Analysis:

    • Search for conserved domains using tools like Pfam, PROSITE, and InterPro

    • Identify functional motifs that might suggest biochemical activities

    • Predict structural features using tools like AlphaFold2

  • Transcriptome Data Mining:

    • Analyze co-expression patterns across 1,027 microarray profiles

    • Identify conditions where AtMg00150 shows significant expression changes

    • Cluster with genes of known function to predict potential pathways

These approaches should be used in combination rather than isolation, as the integration of multiple data types has proven most effective for functional prediction .

How does AtMg00150 contribute to plant stress responses based on current evidence?

While direct evidence for AtMg00150's role in stress responses is limited, the broader context of mitochondrial protein function in Arabidopsis provides valuable insights:

  • Stress Response Networks:

    • Research has identified specific subnetworks of mitochondrial proteins that function in response to diverse environmental stresses, including salt, drought, cold, and wounding

    • As an uncharacterized mitochondrial protein, AtMg00150 may participate in these responses

  • Expression Pattern Evidence:

    • Mitochondrial gene expression is often altered under stress conditions

    • The regulation of mitochondrial proteins like AtMg00150 likely involves retrograde signaling from mitochondria to the nucleus

  • Organelle Communication:

    • The organelle-nucleus-plasmodesmata signaling pathway suggests that mitochondrial proteins contribute to cellular responses to environmental stresses

    • This pathway may involve AtMg00150 as part of the mitochondrial component

  • Experimental Approach for Investigation:

    • Analyze AtMg00150 expression under various stress conditions

    • Create transgenic plants with altered AtMg00150 expression and assess stress tolerance

    • Compare metabolic profiles of wild-type and AtMg00150-modified plants under stress

Understanding AtMg00150's potential role in stress responses will require targeted experiments exposing plants with altered AtMg00150 expression to various stressors and measuring physiological and molecular responses.

What are the most promising research directions for understanding the function of AtMg00150?

Based on current knowledge gaps and available technologies, the following research directions hold the greatest promise for elucidating AtMg00150 function:

  • CRISPR/Cas9 Genome Editing:

    • Generate precise knockout mutants of AtMg00150

    • Create allelic series with partial function

    • Introduce tagged versions at the endogenous locus

  • Interactome Mapping:

    • Perform BioID or proximity labeling experiments with AtMg00150 as bait

    • Conduct co-immunoprecipitation followed by mass spectrometry

    • Map the physical interaction network around AtMg00150

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data from AtMg00150 mutants

    • Apply systems biology approaches to identify affected pathways

    • Use computational modeling to predict functional roles

  • Cross-species Complementation:

    • Test whether AtMg00150 orthologs from other species can complement Arabidopsis mutants

    • Identify conserved and divergent functions across plant lineages

  • Organelle Communication Studies:

    • Investigate AtMg00150's role in mitochondria-plastid-nucleus communication

    • Examine effects on plasmodesmata structure and function

    • Study retrograde signaling in AtMg00150 mutants

  • Structural Biology:

    • Determine the three-dimensional structure of AtMg00150

    • Identify potential binding sites or catalytic domains

    • Use structure to inform function and design targeted mutations

These research directions, particularly when pursued in parallel, offer complementary insights that together can substantially advance understanding of AtMg00150 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.