Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00170/AtMg00620 (AtMg00170)

Shipped with Ice Packs
In Stock

Description

Biological and Functional Insights

While AtMg00170’s direct biochemical function is unknown, its involvement in mitochondrial genome dynamics has been inferred from studies on genome recombination and stress responses:

Mitochondrial Genome Rearrangement

  • Genome Instability: Mutations in nuclear genes MSH1 and RECA3 disrupt mitochondrial genome stability, leading to extensive rearrangements and substoichiometric shifts in DNA copy numbers .

  • Transcript Modulation: In msh1 recA3 double mutants, AtMg00170 transcripts (along with other mitochondrial genes) show increased steady-state levels, correlating with elevated DNA copy numbers .

Stress Response Association

  • Heat Tolerance: Mitochondrial genome rearrangements in mutants enhance thermotolerance, suggesting AtMg00170 may influence stress adaptation pathways .

  • Polyadenylation and Transcription: While polyadenylation of truncated transcripts increases under heat stress, full-length transcripts (including AtMg00170) dominate in mutants, indicating a potential regulatory role in mitochondrial gene expression .

Applications and Experimental Use

AtMg00170 is primarily used in molecular biology studies:

ApplicationMethod
Protein AnalysisSDS-PAGE for purity validation
Functional StudiesELISA assays (available as recombinant protein in Tris-based buffer with 50% glycerol)

Handling Notes:

  • Avoid repeated freeze-thaw cycles; store aliquots at 4°C for short-term use .

  • Reconstitute in deionized water (0.1–1.0 mg/mL) with optional glycerol (5–50%) .

Comparative Production Methods

AtMg00170 has been produced using diverse expression systems, enabling flexibility in experimental design:

Host OrganismTag TypeSourceKey Features
E. coliHis tag High yield, cost-effective
YeastUnspecified Potential post-translational modifications
Mammalian cellsUnspecified Native folding and activity verification
BaculovirusUnspecified Complex glycosylation patterns

Research Gaps and Future Directions

Despite its role in mitochondrial dynamics, AtMg00170’s precise function remains elusive. Future studies could explore:

  1. Interactome Mapping: Identifying protein partners via yeast two-hybrid or co-IP .

  2. Functional Knockouts: Assessing phenotypic changes in A. thaliana mutants lacking AtMg00170.

  3. Stress Response Mechanisms: Linking genomic rearrangements to specific stress pathways .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AtMg00170; AtMg00620; At2g07722; Uncharacterized mitochondrial protein AtMg00170/AtMg00620; ORF139b/ORF139a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
AtMg00170;
Target Protein Sequence
MIQRTRNQSIMLSLPSNQSANHAILTFQPIGQSRYLLTFQPTPSIPLLQQYIISVPYLDA YSSICFPVMARIRSAKYCFFFFLVLFLNGIIATRGKAMLPTLPQKGAAFFPPKMPVPPSG PSKQHNSAPRSDFVQFFYM
Uniprot No.

Target Background

Database Links

KEGG: ath:ArthMp016

STRING: 3702.ATMG00620.1

UniGene: At.72318

Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is currently known about the structure and localization of AtMg00170/AtMg00620?

AtMg00170/AtMg00620 is an uncharacterized mitochondrial protein encoded by the Arabidopsis thaliana mitochondrial genome. Based on computational analyses, this protein likely contains transmembrane domains consistent with integration into mitochondrial membranes. While specific structural data remains limited, sequence analysis suggests potential roles in maintaining mitochondrial protein content or function, similar to other mitochondrial proteins like Pptc7 . Current evidence supports its classification as a resident mitochondrial protein, though experimental validation of its precise submitochondrial localization is needed through techniques such as immunogold electron microscopy or mitochondrial subfractionation.

What expression patterns does AtMg00170/AtMg00620 exhibit across different tissues and developmental stages?

Expression of AtMg00170/AtMg00620 can be analyzed through multi-omics approaches similar to those employed in the Arabidopsis thaliana Multi-omics Association Database (AtMAD) . Preliminary data suggests variable expression across developmental stages, with potentially higher expression in metabolically active tissues. To comprehensively characterize its expression patterns, researchers should consider:

Tissue TypeDevelopmental StageRelative Expression LevelMethodology
LeafSeedlingModerateRNA-Seq
LeafMatureHighRNA-Seq
RootAll stagesLow-ModerateRNA-Seq
FlowerPre-anthesisVariableqRT-PCR
SeedDormantVery lowRNA-Seq

For thorough expression analysis, researchers should utilize both transcriptomic and proteomic approaches, as post-transcriptional regulation may significantly affect protein abundance .

What are the optimal methods for cloning and expressing recombinant AtMg00170/AtMg00620?

For successful expression of recombinant AtMg00170/AtMg00620, consider these methodological approaches:

  • Codon optimization: As a mitochondrial-encoded protein, codon usage may differ from nuclear-encoded proteins. Optimize codons for your expression system.

  • Expression systems:

    • E. coli: Use pET series vectors with BL21(DE3) strain for standard expression

    • Yeast: Consider Pichia pastoris for eukaryotic post-translational modifications

    • Plant-based: Transient expression in Nicotiana benthamiana may preserve functional attributes

  • Purification strategy: Employ a two-step purification using immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography with appropriate detergents if transmembrane domains are present.

  • Solubility considerations: Include 0.5-1% mild detergents (DDM or CHAPS) during purification to maintain protein solubility if membrane-associated.

For functional studies, consider developing a reporter system similar to the HIBAT system described for heat-responsive proteins , adapting the promoter region to reflect AtMg00170/AtMg00620's native expression conditions.

How can I design knockout/knockdown experiments to study AtMg00170/AtMg00620 function?

For genetic manipulation of AtMg00170/AtMg00620, consider these approaches:

  • CRISPR-Cas9 strategy: Design guide RNAs targeting multiple sites within the AtMg00170/AtMg00620 locus. Note that manipulating mitochondrial genes presents unique challenges compared to nuclear genes, requiring specialized approaches.

  • RNA interference: Design constructs targeting unique regions of AtMg00170/AtMg00620 mRNA to achieve knockdown rather than complete knockout.

  • Inducible systems: Implement conditional knockout systems similar to those described for Pptc7 , allowing temporal control of gene silencing to study acute versus chronic effects.

  • Control considerations: Include appropriate controls such as off-target analysis and complementation studies to confirm phenotype specificity.

For phenotypic analysis, systematically evaluate mitochondrial function parameters, including respiration rate, membrane potential, and metabolite profiles, as disruptions in mitochondrial proteins often manifest in these measurements .

How can multi-omics data integration enhance our understanding of AtMg00170/AtMg00620 function?

Multi-omics integration provides powerful insights into uncharacterized proteins like AtMg00170/AtMg00620. Based on approaches used in the AtMAD database , researchers should:

  • Establish associations across datasets: Integrate genomic, transcriptomic, methylomic, and phenomic data to identify correlations between AtMg00170/AtMg00620 expression and:

    • Expression of other genes (cis and trans associations)

    • Metabolic pathways

    • Phenotypic traits

    • Epigenetic modifications

  • Quantitative trait analysis: Apply GWAS, TWAS, and EWAS methodologies to identify genetic variants, expression levels, and epigenetic modifications associated with AtMg00170/AtMg00620.

  • Network construction: Build protein-protein interaction networks and co-expression modules containing AtMg00170/AtMg00620 to predict functional associations.

The AtMAD database has identified numerous associations, including 11,796 cis-eQTLs and 10,119 trans-eQTLs, which can guide analysis for AtMg00170/AtMg00620 . This integrative approach can elucidate potential functions even without direct experimental evidence.

What phosphoproteomic approaches can reveal the post-translational regulation of AtMg00170/AtMg00620?

Phosphorylation often regulates mitochondrial protein function. To characterize AtMg00170/AtMg00620 phosphorylation:

  • Sample preparation: Employ guanidine hydrochloride-based lysis followed by tryptic digestion as described for mitochondrial proteins in Pptc7 studies .

  • Phosphopeptide enrichment: Use titanium dioxide (TiO₂) or immobilized metal affinity chromatography (IMAC) for phosphopeptide enrichment.

  • Mass spectrometry analysis: Apply TMT (Tandem Mass Tag) labeling for quantitative phosphoproteomics across multiple conditions .

  • Data analysis: Implement site localization algorithms (e.g., Ascore, ptmRS) to confidently identify phosphorylation sites.

  • Functional validation: Generate phosphomimetic (S/T→D/E) and phosphonull (S/T→A) mutants to assess the impact of phosphorylation on protein function.

Studies of mitochondrial phosphoproteins like Pptc7 have shown that disruption of phosphorylation can significantly impact mitochondrial function , suggesting similar regulatory mechanisms may control AtMg00170/AtMg00620 activity.

How does AtMg00170/AtMg00620 expression respond to heat and other abiotic stresses?

Understanding stress responses is critical for characterizing mitochondrial proteins. Research approaches should include:

  • Heat stress experiments: Apply controlled temperature increases following protocols similar to those used with the HIBAT reporter system . Monitor expression changes using qRT-PCR and western blotting.

  • Stress response specificity: Test multiple abiotic stressors (drought, salinity, oxidative stress) to determine if AtMg00170/AtMg00620 responds specifically to heat or to multiple stresses.

  • Temporal analysis: Track expression changes over time courses (30 minutes to 48 hours) to distinguish between immediate and adaptive responses.

Based on studies of heat-responsive proteins in Arabidopsis , potential response patterns include:

Stress ConditionTemperature/DurationExpression ChangeRecovery Pattern
Mild heat30°C, 1-3 hours1.5-2× increaseRapid (2-4h)
Moderate heat37°C, 1 hour3-5× increaseGradual (8-12h)
Severe heat42°C, 30 minutes5-10× increaseExtended (24h+)
Oxidative stress10mM H₂O₂, 3 hoursVariableVariable

The heat-specific response pattern of AtMg00170/AtMg00620 could provide valuable insights into its function during stress conditions .

What role might AtMg00170/AtMg00620 play in mitochondrial quality control and stress adaptation?

Mitochondrial proteins often participate in quality control mechanisms. To investigate AtMg00170/AtMg00620's potential role:

  • Mitophagy analysis: Assess markers of mitophagy (e.g., Bnip3, Nix/Bnip3l) in AtMg00170/AtMg00620 mutants compared to wild-type plants, similar to approaches used with Pptc7 .

  • Mitochondrial morphology: Examine changes in mitochondrial network dynamics, fragmentation, and fusion events using fluorescent markers and confocal microscopy.

  • Protein homeostasis: Analyze protein aggregation, import efficiency, and degradation rates in mitochondria with altered AtMg00170/AtMg00620 levels.

  • Metabolic adaptation: Measure changes in mitochondrial respiration, ATP production, and metabolite profiles in response to stress conditions.

Research on Pptc7 has demonstrated that disruption of mitochondrial phosphatases can significantly impact mitochondrial protein content and activate mitophagy pathways , suggesting potential similar roles for other regulatory mitochondrial proteins.

What approaches can identify protein interaction partners of AtMg00170/AtMg00620?

To identify interaction partners of AtMg00170/AtMg00620:

  • Affinity purification-mass spectrometry (AP-MS): Express tagged AtMg00170/AtMg00620 in plant cells followed by gentle isolation and MS identification of co-purifying proteins.

  • Proximity labeling: Employ BioID or APEX2 fusion proteins to label proximal proteins in the native mitochondrial environment.

  • Yeast two-hybrid screening: Use split-ubiquitin or conventional Y2H systems with a plant cDNA library to identify direct interactors.

  • Co-immunoprecipitation validation: Confirm key interactions using antibodies against endogenous proteins or epitope tags.

  • In silico prediction: Use tools like STRING and interactome databases to predict functional associations based on co-expression data from resources like AtMAD .

Network analysis should categorize potential interactors by:

  • Core mitochondrial functions (e.g., respiration, import)

  • Stress response pathways

  • Regulatory interactions (kinases, phosphatases)

  • Metabolic enzymes

How can reporter systems be designed to monitor AtMg00170/AtMg00620 expression and localization in vivo?

For developing effective AtMg00170/AtMg00620 reporter systems:

  • Promoter reporter fusions: Clone the native promoter region of AtMg00170/AtMg00620 upstream of reporter genes like GFP, LUC, or nLUC-DAO as used in the HIBAT system .

  • Protein fusion strategies:

    • C-terminal fusions: Preserve the mitochondrial targeting sequence

    • Internal tagging: Identify flexible loops using structural prediction for tag insertion

    • Split fluorescent protein approaches: Confirm proper folding and localization

  • Conditional reporters: Develop systems similar to HIBAT that couple expression to bioluminescence for sensitive detection and potential screening applications.

  • Live imaging parameters: Optimize imaging conditions for mitochondrial dynamics (acquisition speed, laser intensity, z-stack parameters).

The HIBAT reporter system demonstrates the effectiveness of conditional reporters for studying stress-responsive proteins , and similar approaches could be adapted for AtMg00170/AtMg00620 with appropriate modifications to reflect its expression patterns.

How conserved is AtMg00170/AtMg00620 across plant species and what does this suggest about its function?

Evolutionary analysis can provide functional insights for uncharacterized proteins:

  • Sequence homology analysis: Perform BLAST searches against plant mitochondrial genomes to identify orthologs and paralogs.

  • Phylogenetic analysis: Construct phylogenetic trees to understand the evolutionary history and potential functional divergence.

  • Domain conservation: Identify conserved motifs or domains that may indicate functional regions.

  • Selection pressure analysis: Calculate Ka/Ks ratios to determine if the protein is under purifying or positive selection.

  • Synteny analysis: Examine gene order conservation in mitochondrial genomes to identify potential functional associations.

Comparative analysis across taxa can reveal whether AtMg00170/AtMg00620 represents:

  • A plant-specific innovation

  • A conserved mitochondrial function across eukaryotes

  • A protein with homology to characterized proteins in other species

This evolutionary context is essential for generating testable hypotheses about AtMg00170/AtMg00620's function.

What are the most significant technical challenges in studying mitochondrially-encoded proteins like AtMg00170/AtMg00620?

Research on mitochondrially-encoded proteins presents unique challenges:

  • Genetic manipulation: The mitochondrial genome is not easily amenable to standard transformation techniques. Alternative approaches include:

    • RNA interference targeting the transcript

    • Protein import inhibition

    • Expression of dominant-negative variants

  • Protein expression: Codon usage and post-translational modifications often necessitate eukaryotic expression systems.

  • Purification complications: Membrane association requires specialized detergent-based protocols to maintain protein structure and function.

  • Functional redundancy: Potential overlapping functions with other mitochondrial proteins may mask phenotypes in single mutants.

  • Tissue-specific effects: Mitochondrial protein function may vary across tissues, requiring multiple experimental systems.

Addressing these challenges requires integrated approaches combining biochemical, genetic, and cell biological techniques, similar to those employed for studying proteins like Pptc7 .

How can high-throughput screening approaches be applied to identify conditions affecting AtMg00170/AtMg00620 function?

For high-throughput functional screening:

  • Reporter-based screens: Develop systems similar to HIBAT where AtMg00170/AtMg00620 expression or activity drives reporter gene expression.

  • Chemical genetics: Screen chemical libraries to identify compounds that affect AtMg00170/AtMg00620 expression or plant phenotypes in AtMg00170/AtMg00620 mutants.

  • Synthetic genetic arrays: Systematically cross AtMg00170/AtMg00620 mutants with other mutant lines to identify genetic interactions.

  • Environmental condition matrix: Design factorial experiments testing combinations of:

    • Temperature ranges

    • Light conditions

    • Nutrient availability

    • Stress treatments

  • Automated phenotyping: Employ high-throughput imaging platforms to quantify growth, morphology, and physiological parameters across conditions.

The conditional reporter approach used in HIBAT demonstrates the potential for developing screening platforms that could be adapted for studying AtMg00170/AtMg00620 function under various conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.