Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00370 (AtMg00370)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
AtMg00370; At2g07739; Uncharacterized mitochondrial protein AtMg00370; ORF199
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
AtMg00370;
Target Protein Sequence
MVFQSFILGNLVYLCMKIINSVVVVGLYYGFLTTFSIGPSYLFLLRARVMDEGEEGTEKK VSATTGFIAGQLMMFISIYYAPLHLALGRPHTITVLALPYLLFHFFFWNNHKHFFDYGST TRNEMRNLRIQCVFPNNLIFKLFNHLILPSSMLARLVNIYMFRCNNKMLFVTSSFVVCVR MLLVEWAFPLFQLFLVMKV
Uniprot No.

Target Background

Database Links

KEGG: ath:ArthMp033

STRING: 3702.ATMG00370.1

UniGene: At.72565

Protein Families
Ycf1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • What are the current hypotheses about the function of AtMg00370 based on its family and ortholog annotations?

    While AtMg00370 remains largely uncharacterized, several hypotheses about its function can be derived from available data:

    1. Protein Transport Function: Some orthologs of AtMg00370 are annotated as "Protein Tic 214," suggesting it might function in protein import into mitochondria or chloroplasts .

    2. Membrane-Related Function: The protein is predicted to be a multi-pass membrane protein, indicating it likely functions in membrane transport or as a structural component of mitochondrial membranes .

    3. Mitochondrial Genome Maintenance: Given the importance of other mitochondrial proteins in genome maintenance and expression, AtMg00370 might play a role in mitochondrial DNA stability or expression regulation, similar to other mitochondrial proteins described in the literature .

    4. RNA Processing Role: Considering the extensive RNA processing in plant mitochondria, AtMg00370 could potentially be involved in RNA editing, splicing, or stability mechanisms that are crucial for proper mitochondrial function .

  • How might AtMg00370 be involved in plant mitochondrial stress responses?

    Research on plant mitochondrial proteins has revealed important connections between mitochondrial function and stress responses:

    1. Plants with mutations affecting mitochondrial genome stability (e.g., msh1 recA3 double mutants) show enhanced thermotolerance and activation of stress response pathways .

    2. Mitochondrial dysfunction can trigger retrograde signaling pathways that activate nuclear gene expression changes, particularly through transcription factors like ANAC017 .

    3. If AtMg00370 plays a role in mitochondrial membrane integrity or protein import, its dysfunction could potentially trigger similar stress responses.

    To investigate this connection experimentally, researchers could:

    • Generate AtMg00370 knockout or knockdown lines

    • Analyze transcriptome changes in these lines under normal and stress conditions

    • Assess thermotolerance and other stress responses

    • Examine the activation of known mitochondrial retrograde signaling pathways

  • What research techniques are most appropriate for studying the RNA editing and processing of AtMg00370 transcripts?

    Given the extensive RNA editing in plant mitochondria (over 500 C-to-U editing sites in Arabidopsis mitochondrial transcripts) , investigating RNA processing of AtMg00370 requires specialized techniques:

    1. Direct RNA Sequencing: Long-read sequencing technologies (Oxford Nanopore) can capture full-length transcripts to identify all RNA editing sites simultaneously.

    2. RT-PCR and Sanger Sequencing: Comparing genomic and cDNA sequences to identify C-to-U editing sites.

    3. RNA-seq Analysis: Using specialized bioinformatics pipelines to detect RNA editing sites from short-read RNA-seq data.

    4. Comparison with PPR Mutants: RNA editing is often mediated by pentatricopeptide repeat (PPR) proteins. Comparing RNA editing patterns in AtMg00370 across wild-type and PPR mutant lines (e.g., gend2-1) could reveal which PPR proteins edit this transcript .

    5. In Vitro RNA Editing Assays: Reconstituting the RNA editing machinery in vitro to study the editing of specific sites.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.