Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00670 (AtMg00670)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AtMg00670; Uncharacterized mitochondrial protein AtMg00670; ORF275
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-275
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
AtMg00670
Target Protein Sequence
MKKYKMVINIDMLRLFLPLLGGSVSGSLFGRFLGSEGSAIMITTCVSFCALVVFIFGLFY FRKKGPLKRILYLFLVGFVLSLIRIKVVYLLGGQALPLLDPILMYAVGAGALLGPNGAES SATWEEDSFELDVLGESFSSSKTDMDSQVAEAPQTEEGEPSVNQVPQEAGASHRVGPYQD QGLATDRNGNPIDLNDSLPPSSLLYGEIESSASVRARDLELEKDIKRVQRLTRNFDNAED PARRLEVAARLDPEVRELDQKWALFQEKDASGLGR
Uniprot No.

Target Background

Database Links
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is AtMg00670 and why is it significant for plant research?

AtMg00670 is an uncharacterized mitochondrial protein encoded in the Arabidopsis thaliana mitochondrial genome. It is also known as ORF275 and has a UniProt ID of P93319. The protein consists of 275 amino acids and while its specific function remains unknown, its mitochondrial localization suggests potential involvement in energy metabolism, organellar gene expression, or stress responses .

The significance of studying this protein lies in advancing our understanding of mitochondrial biology in plants. As a model organism, insights from A. thaliana can be translated to agriculturally important species. Uncharacterized proteins represent knowledge gaps in our understanding of cellular processes, and elucidating their functions can reveal novel biological mechanisms relevant to plant adaptation and survival.

What are the known structural features and domains of AtMg00670?

The presence of charged amino acid clusters (e.g., "FRKKGPLKR") suggests potential nucleic acid binding regions or protein-protein interaction sites. The protein likely contains signal sequences for mitochondrial targeting at its N-terminus. Comprehensive structural characterization would require experimental approaches such as X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy, which have not been reported in the available literature for this protein.

What experimental design approaches are recommended for functional characterization of AtMg00670?

For rigorous functional characterization of AtMg00670, a multi-faceted experimental approach is recommended, following established principles of experimental design:

  • Gene Knockout/Knockdown Studies:

    • CRISPR-Cas9 targeted mutagenesis or RNAi-mediated knockdown

    • Complementation testing with the wild-type gene to confirm phenotype attribution

    • Phenotypic analysis across different developmental stages and stress conditions

  • Protein Localization:

    • Fluorescent protein tagging (ensuring tag doesn't interfere with targeting signals)

    • Immunogold electron microscopy for precise submitochondrial localization

    • Cell fractionation followed by Western blotting

  • Interaction Studies:

    • Co-immunoprecipitation followed by mass spectrometry

    • Yeast two-hybrid or split-ubiquitin assays

    • Proximity labeling approaches (BioID or APEX)

  • Expression Analysis:

    • Quantitative RT-PCR across tissues and conditions

    • RNA-Seq for global transcriptional effects of protein absence/overexpression

    • Proteomics to identify affected pathways

These approaches should follow proper experimental design principles, including randomization, replication, and appropriate controls as outlined in research design literature . A true experimental design with pre-test/post-test control group design or Solomon four-group design would provide the most robust results when testing functional hypotheses.

How can researchers address potential contradictory results when studying AtMg00670?

When confronting contradictory results in AtMg00670 research, apply these systematic approaches:

  • Methodological Validation:

    • Verify antibody specificity through western blots and knockout controls

    • Ensure recombinant protein properly folds using circular dichroism or limited proteolysis

    • Validate subcellular fractionation purity with established markers

  • Data Analysis and Interpretation:

    • Apply appropriate statistical tests and corrections for multiple comparisons

    • Consider alternative explanations for observations

    • Examine whether contradictions arise from differences in experimental conditions

  • Experimental Design Refinement:

    • Implement factorial designs to test for interaction effects between variables

    • Consider developmental timing, tissue specificity, and environmental conditions

    • Use inducible systems to differentiate primary from secondary effects

  • Systematic Literature Review:

    • Construct a consensus matrix of findings across studies

    • Identify variables that correlate with divergent outcomes

    • Consider evolutionary conservation by examining orthologs in related species

When publishing, transparently report all contradictory findings and hypotheses explaining discrepancies. This approach follows sound scientific methodology principles that enhance reproducibility and reliability of research findings .

What are the crucial considerations for designing RNA-Seq experiments to study AtMg00670 regulation and impact?

When designing RNA-Seq experiments to investigate AtMg00670 regulation and impact, researchers should consider:

  • Experimental Design:

    • Implement a factorial design including genotype (wild-type vs. mutant), environmental conditions, and developmental stages

    • Include at least 3-4 biological replicates per condition for statistical power

    • Consider time-course experiments to capture dynamic responses

    • Include appropriate controls for genetic background effects

  • Sample Preparation:

    • Use standardized protocols for RNA extraction to minimize technical variation

    • Ensure RNA integrity (RIN > 8) for reliable sequencing results

    • Consider subcellular fractionation to enrich for mitochondrial transcripts

    • Include spike-in controls for normalization validation

  • Sequencing Considerations:

    • Determine appropriate sequencing depth (minimum 20-30 million reads for differential expression analysis)

    • Consider strand-specific sequencing to identify antisense transcripts

    • Use paired-end sequencing for better transcript assembly and splice variant detection

    • Consider long-read sequencing for isoform identification

  • Data Analysis:

    • Evaluate differential expression of transcripts

    • Analyze differential alternative splicing, particularly in relation to PRL1/PRL2 splicing factors which may interact with AtMg00670 function

    • Perform GO-term enrichment analysis to identify affected pathways

    • Examine changes in 5' and 3' termini that may affect protein function

  • Validation:

    • Confirm key findings with quantitative RT-PCR

    • Validate protein-level changes through proteomics or western blotting

    • Test functional predictions through molecular or genetic approaches

This comprehensive approach enables robust characterization of AtMg00670's regulatory networks and functional impact on cellular processes .

What are the optimal conditions for the expression and purification of recombinant AtMg00670?

Based on available research data, the optimal conditions for expression and purification of recombinant AtMg00670 are:

Expression System:

  • Host: E. coli has been successfully used for expression

  • Vector: Those containing strong inducible promoters (T7, tac, etc.)

  • Tag Configuration: N-terminal His-tag has been validated

  • Expression Conditions:

    • Induction at OD600 of 0.6-0.8

    • IPTG concentration: 0.5-1.0 mM

    • Post-induction temperature: 18-25°C (lower temperature may improve folding)

    • Induction duration: 16-18 hours

Purification Protocol:

  • Cell lysis using sonication or pressure-based methods in Tris-based buffer

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Optional second purification step: Size exclusion chromatography

  • Final product preparation: Lyophilization for long-term storage

Quality Control:

  • SDS-PAGE analysis confirms purity >90%

  • Western blot verification with anti-His antibodies

  • Mass spectrometry validation of intact mass and sequence coverage

These conditions provide a framework for obtaining high-quality recombinant AtMg00670 suitable for downstream applications in biochemical and structural studies.

How should recombinant AtMg00670 be stored and handled to maintain optimal activity?

For optimal stability and activity maintenance of recombinant AtMg00670, follow these evidence-based storage and handling protocols:

Long-term Storage:

  • Store lyophilized powder at -20°C to -80°C

  • Avoid repeated freeze-thaw cycles

  • Aliquot upon initial reconstitution to minimize freeze-thaw events

Reconstitution:

  • Briefly centrifuge vial prior to opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% for cryoprotection

Working Solutions:

  • Store working aliquots at 4°C for up to one week

  • Use Tris/PBS-based buffer, pH 8.0, containing 6% Trehalose

  • For frequent use, prepare smaller aliquots to minimize stability issues

Stability Considerations:

  • The protein may undergo time-dependent aggregation at room temperature

  • Exposure to oxidizing agents should be minimized

  • Avoid repeated pipetting to minimize denaturation from air-water interfaces

Quality Control:

  • Periodically verify protein integrity via SDS-PAGE

  • Monitor activity using appropriate functional assays

  • Document any observed changes in solubility or activity

Following these guidelines will help ensure the highest quality and reproducibility in experiments utilizing recombinant AtMg00670 .

What analytical techniques are most effective for studying the interactions of AtMg00670 with other cellular components?

To effectively study AtMg00670 interactions with other cellular components, researchers should consider these analytical approaches:

In Vitro Interaction Analysis:

  • Surface Plasmon Resonance (SPR):

    • Provides real-time kinetic measurements of binding events

    • Requires immobilization of purified AtMg00670 or potential binding partners

    • Enables determination of association/dissociation constants

  • Isothermal Titration Calorimetry (ITC):

    • Measures thermodynamic parameters of binding in solution

    • No immobilization or labeling required

    • Provides stoichiometry, binding affinity, and thermodynamic profile

  • Microscale Thermophoresis (MST):

    • Requires minimal sample amounts

    • Works with complex biological fluids

    • Detects interactions based on changes in thermophoretic movement

In Vivo Interaction Analysis:

  • Co-Immunoprecipitation (Co-IP):

    • Can be performed with antibodies against AtMg00670 or against tagged versions

    • Coupled with mass spectrometry for unbiased identification of interaction partners

    • Preserves native protein complexes

  • Proximity-Dependent Labeling:

    • BioID or APEX2 fusion proteins generate reactive biotin species that label nearby proteins

    • Particularly useful for transient or weak interactions

    • Effective for membrane proteins in their native environment

  • Fluorescence Techniques:

    • Förster Resonance Energy Transfer (FRET) for direct protein-protein interactions

    • Fluorescence Recovery After Photobleaching (FRAP) for dynamics within complexes

    • Bimolecular Fluorescence Complementation (BiFC) for visualization of interactions in vivo

Structural Analysis of Complexes:

  • Cryo-Electron Microscopy:

    • Visualizes protein complexes at near-atomic resolution

    • Minimal sample preparation preserves native states

    • Particularly useful for large molecular assemblies

  • Cross-linking Mass Spectrometry (XL-MS):

    • Provides spatial constraints for protein-protein interactions

    • Compatible with complex samples

    • Identifies direct protein contacts

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Maps interaction interfaces through differential solvent accessibility

    • Detects conformational changes upon binding

    • Works with large protein complexes

These techniques provide complementary information and should be selected based on the specific research question, available resources, and nature of the hypothesized interactions .

What statistical approaches are most appropriate for analyzing differential expression of AtMg00670 under various experimental conditions?

When analyzing differential expression of AtMg00670 across experimental conditions, researchers should implement these statistical approaches:

Experimental Design Considerations:

  • Include minimum 3-5 biological replicates per condition for adequate statistical power

  • Control for batch effects through randomization and blocking designs

  • Consider time-series designs for temporal expression patterns

Normalization Methods:

  • For qRT-PCR data:

    • Use multiple reference genes validated for stability (e.g., ACT2, UBQ10, EF1α)

    • Apply geNorm or NormFinder to select optimal reference gene combinations

    • Calculate relative expression using 2^(-ΔΔCt) or efficiency-corrected methods

  • For RNA-Seq data:

    • Apply TMM (Trimmed Mean of M-values) or DESeq2 normalization

    • Perform FPKM/RPKM/TPM transformations for between-sample comparisons

    • Use spike-in controls for absolute quantification when appropriate

Statistical Tests:

  • Parametric approaches:

    • Two-sample t-test for simple two-condition comparisons

    • ANOVA with post-hoc tests for multi-condition experiments

    • Linear mixed models for complex experimental designs with random effects

  • Non-parametric alternatives:

    • Mann-Whitney U test or Wilcoxon signed-rank test

    • Kruskal-Wallis with Dunn's post-test for multiple comparisons

  • RNA-Seq specific methods:

    • DESeq2 or edgeR for count-based differential expression analysis

    • Limma-voom for complex experimental designs

Multiple Testing Correction:

  • Apply Benjamini-Hochberg procedure to control false discovery rate

  • Use Bonferroni correction when strict control of family-wise error rate is required

  • Consider adaptive procedures for large-scale analyses

Visualization and Reporting:

  • Present complete statistical parameters (test statistic, degrees of freedom, exact p-values)

  • Generate volcano plots highlighting fold change and significance

  • Produce heat maps for multi-condition or time-course experiments

  • Create box plots showing individual data points for transparency

These approaches align with current best practices in gene expression analysis and ensure reliable interpretation of AtMg00670 expression patterns across experimental conditions .

How can researchers differentiate between direct and indirect effects when studying the functional impact of AtMg00670?

Differentiating between direct and indirect effects in AtMg00670 functional studies requires a systematic approach combining multiple lines of evidence:

Temporal Analysis:

  • Time-Course Experiments:

    • Monitor cellular changes at multiple time points after AtMg00670 perturbation

    • Early responses (minutes to hours) are more likely to represent direct effects

    • Later responses (hours to days) often reflect secondary or tertiary effects

    • Apply temporal clustering to identify co-regulated processes

  • Inducible Systems:

    • Use chemically inducible or temperature-sensitive systems for controlled expression

    • Rapidly inducible promoters (e.g., dexamethasone, ethanol-inducible) permit precise timing

    • Correlate the kinetics of AtMg00670 activity with observed phenotypes

Molecular Approaches:

  • Direct Binding Assays:

    • Chromatin immunoprecipitation (ChIP) to identify DNA binding sites (if relevant)

    • RNA immunoprecipitation (RIP) to detect RNA interactions

    • Protein interaction studies with putative targets using in vitro binding assays

    • Apply proper controls including binding-deficient mutants

  • Proximity Labeling:

    • BioID or APEX2 fusion proteins to identify proteins in close proximity

    • Allows temporal resolution of protein neighborhoods

    • Compare with standard protein-protein interaction datasets

Genetic Approaches:

  • Epistasis Analysis:

    • Create double mutants between AtMg00670 and genes in putative pathways

    • Analyze phenotypes to establish genetic hierarchies

    • Use this information to build pathway models that predict direct vs. indirect effects

  • Targeted Rescue Experiments:

    • Express specific downstream factors in AtMg00670 mutant background

    • Rescue of specific phenotypes suggests those effects are indirect

    • Failure to rescue indicates either direct effects or parallel pathways

Computational Methods:

  • Network Analysis:

    • Integrate transcriptomic, proteomic, and metabolomic data into interaction networks

    • Apply algorithms to identify direct regulatory connections

    • Use Bayesian approaches to calculate probability of direct vs. indirect relationships

  • Comparative Analysis:

    • Study effects across multiple species with AtMg00670 orthologs

    • Direct targets are more likely to be evolutionarily conserved

    • Cross-reference with known mitochondrial protein functions

When reporting results, clearly distinguish between experimentally validated direct effects and those inferred from correlative evidence .

What bioinformatic tools and databases are most useful for predicting the function of uncharacterized proteins like AtMg00670?

To predict functions of uncharacterized proteins like AtMg00670, researchers should utilize these bioinformatic tools and databases:

Sequence-Based Analysis Tools:

  • Homology Detection:

    • BLAST/PSI-BLAST for sequence similarity searches

    • HHpred for remote homology detection using hidden Markov models

    • HMMER for profile-based searches against protein family databases

  • Domain and Motif Identification:

    • InterProScan for comprehensive domain analysis

    • SMART for identification of signaling domains

    • ELM (Eukaryotic Linear Motif) for short functional motifs

    • TMHMM/TOPCONS for transmembrane domain prediction

  • Subcellular Localization:

    • TargetP and MitoFates for mitochondrial targeting prediction

    • WOLF PSORT for general eukaryotic localization prediction

    • MitoCarta/MitoMiner for curated mitochondrial protein databases

Structure-Based Methods:

  • Structure Prediction:

    • AlphaFold2/RoseTTAFold for accurate 3D structure prediction

    • SWISS-MODEL for homology modeling

    • I-TASSER for integrated structure and function prediction

  • Structural Comparison:

    • DALI for comparing predicted structures to known protein folds

    • ProFunc for function prediction from structure

Function Prediction Resources:

  • Specialized Databases:

    • UniProt for curated protein information

    • TAIR for Arabidopsis-specific information

    • PLAZA for plant comparative genomics

    • SUBA4 for Arabidopsis subcellular localization data

  • Function Prediction Servers:

    • COFACTOR for enzyme classification and binding site prediction

    • DeepGOPlus for Gene Ontology term prediction

    • FFPred for feature-based function prediction

Network-Based Approaches:

  • Co-expression Analysis:

    • ATTED-II for plant gene co-expression networks

    • Expression Atlas for expression pattern comparison

  • Protein-Protein Interaction:

    • STRING for predicted and known protein interactions

    • BioGRID for curated interaction data

    • IntAct for experimentally validated interactions

  • Pathway Analysis:

    • KEGG for metabolic and signaling pathway mapping

    • AraCyc for Arabidopsis-specific pathway information

    • MapMan for visualization of cellular processes

Integrative Analysis:

Analysis TypeTool NameKey FeaturesAppropriate Use Case
Meta-serversCAFACommunity-based assessment of function predictionBenchmark against multiple methods
ProteinsPlusComprehensive analysis platformOne-stop analysis of new proteins
Data IntegrationAraportIntegrated Arabidopsis resourcesArabidopsis-focused studies
CytoscapeNetwork visualization and analysisIntegration of multiple datasets
Machine LearningDeepFRIDeep learning for function predictionWhen conventional methods fail
FunFamsFunctional family assignmentClassification into functional groups

For uncharacterized mitochondrial proteins like AtMg00670, combining these approaches creates a comprehensive functional hypothesis that can guide experimental validation .

What are the most promising applications of AtMg00670 research in plant science?

Research on AtMg00670 has several promising applications in plant science, spanning basic and applied research domains:

Fundamental Plant Biology:

  • Elucidation of novel mitochondrial functions and regulatory mechanisms

  • Understanding nuclear-mitochondrial communication in plants

  • Insights into plant-specific adaptations in organellar biology

  • Contributions to completing the functional annotation of the Arabidopsis mitochondrial genome

Stress Response and Adaptation:

  • Potential roles in plant responses to abiotic stresses (temperature, drought, oxidative stress)

  • Involvement in metabolic adjustments during stress conditions

  • Contributions to mitochondrial quality control and homeostasis

  • Possible functions in retrograde signaling from mitochondria to nucleus

Agricultural Applications:

  • Identification of targets for improving crop stress resilience

  • Potential enhancement of plant energy efficiency and yield stability

  • Development of biomarkers for plant health monitoring

  • Insights for metabolic engineering of crops for improved performance

Evolutionary Biology:

  • Understanding the evolution of mitochondrial genomes in plants

  • Comparative analysis across species to identify conserved functions

  • Investigation of mitochondrial gene transfer to the nucleus

  • Insights into endosymbiotic gene retention and function

Technological Developments:

  • New tools for mitochondrial protein analysis in plants

  • Improved methodologies for characterizing membrane proteins

  • Advanced approaches for studying protein-protein interactions in organelles

  • Novel genetic engineering strategies targeting organellar functions

These applications highlight the significance of continued research on AtMg00670 and similar uncharacterized mitochondrial proteins for advancing both fundamental understanding and practical applications in plant science .

How can research on AtMg00670 inform our understanding of mitochondrial function in plants?

Research on AtMg00670 provides multiple avenues to enhance our understanding of plant mitochondrial function:

Mitochondrial Genome Expression:

  • AtMg00670 is encoded by the mitochondrial genome, offering insights into organelle-specific gene expression

  • Studies may reveal novel mechanisms of mitochondrial gene regulation

  • Potentially illuminates coordination between mitochondrial and nuclear genomes

  • May identify factors involved in post-transcriptional processing of mitochondrial transcripts

Organellar Protein Import and Assembly:

  • Although mitochondrially encoded, AtMg00670 must be assembled with nuclear-encoded proteins

  • Research can elucidate assembly mechanisms for multi-subunit complexes

  • Studies may reveal quality control processes for mitochondrial proteins

  • Could identify novel chaperones or assembly factors specific to plant mitochondria

Mitochondrial Membrane Organization:

  • Hydrophobic regions in AtMg00670 suggest membrane localization

  • Research may reveal roles in maintaining cristae structure or membrane potential

  • Could identify novel membrane complexes specific to plant mitochondria

  • May elucidate membrane dynamics during mitochondrial division or fusion

Stress Response Mechanisms:

  • Studies examining AtMg00670 expression under various stresses may reveal specific roles in stress adaptation

  • Could identify novel mitochondrial stress response pathways in plants

  • Research may reveal connections between mitochondrial function and whole-plant stress responses

  • May identify retrograde signaling components between mitochondria and nucleus

Metabolic Regulation:

  • Characterization may reveal connections to metabolic pathways

  • Could identify roles in respiratory complex assembly or function

  • May elucidate plant-specific aspects of mitochondrial metabolism

  • Research might reveal connections between mitochondrial function and photosynthesis

Evolutionary Perspectives:

  • Comparative studies across species may reveal evolutionary conservation or divergence

  • Could identify plant-specific innovations in mitochondrial function

  • May help understand why certain genes remain mitochondrially encoded

  • Research might reveal functional constraints that prevent nuclear transfer of certain genes

By addressing these aspects, AtMg00670 research contributes to filling critical knowledge gaps in plant mitochondrial biology, potentially revealing unique adaptations that distinguish plant mitochondria from those of other eukaryotes .

What are the most significant technical challenges in studying AtMg00670, and how can they be addressed?

Studying the uncharacterized mitochondrial protein AtMg00670 presents several technical challenges that require innovative approaches:

Challenge 1: Genetic Manipulation of Mitochondrially-Encoded Genes

  • Difficulty: Unlike nuclear genes, direct transformation of plant mitochondrial DNA remains technically challenging

  • Solutions:

    • Employ RNA interference or antisense approaches targeting the transcript

    • Use TALEN or CRISPR-based technologies adapted for mitochondrial targeting

    • Implement transplastomic approaches in species where mitochondrial transformation is possible

    • Develop inducible peptide nucleic acid (PNA) technology to transiently inhibit expression

Challenge 2: Protein Expression and Purification

  • Difficulty: Mitochondrial membrane proteins often present solubility and stability issues

  • Solutions:

    • Optimize heterologous expression using specialized E. coli strains designed for membrane proteins

    • Employ detergent screening to identify optimal solubilization conditions

    • Use nanodiscs or amphipols to maintain native-like membrane environment

    • Consider cell-free expression systems with supplied lipids

Challenge 3: Functional Assays for Uncharacterized Proteins

  • Difficulty: Without known function, designing appropriate assays is challenging

  • Solutions:

    • Implement unbiased metabolomic and proteomic profiling in wild-type vs. mutant contexts

    • Develop comprehensive interaction screens (Y2H, BioID, etc.) to identify functional partners

    • Use comparative approaches across species to identify contextual patterns

    • Apply activity-based protein profiling to detect biochemical activities

Challenge 4: Localization within Mitochondria

  • Difficulty: Precise submitochondrial localization requires specialized techniques

  • Solutions:

    • Develop antibodies specific to AtMg00670 for immunogold electron microscopy

    • Use proximity labeling approaches combined with mass spectrometry

    • Implement super-resolution microscopy with appropriate tags

    • Apply biochemical fractionation with validation using known submitochondrial markers

Challenge 5: Low Abundance and Detection Limits

  • Difficulty: Mitochondrial proteins may be expressed at low levels

  • Solutions:

    • Implement targeted proteomics (SRM/MRM) for sensitive detection

    • Develop enrichment strategies specific for AtMg00670

    • Use amplification-based detection methods for transcripts

    • Consider tissue-specific or condition-specific expression analysis

Challenge 6: Connecting Molecular Function to Physiological Role

  • Difficulty: Bridging biochemical activities to whole-plant phenotypes

  • Solutions:

    • Implement reverse genetic screens in conditional backgrounds

    • Develop tissue-specific or inducible systems for spatial and temporal control

    • Use sophisticated phenotyping platforms for subtle phenotype detection

    • Integrate multi-omics data with machine learning for prediction of physiological impacts

By addressing these challenges through methodological innovation and interdisciplinary approaches, researchers can overcome the technical barriers to understanding AtMg00670 function and its broader implications for plant biology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.