Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00910 (AtMg00910)

What is AtMg00910 and what is known about its basic properties?

AtMg00910 is an uncharacterized mitochondrial protein from Arabidopsis thaliana with a full length of 215 amino acids. The protein is available commercially as a recombinant protein with an N-terminal His-tag for purification and identification purposes. Current analysis indicates it is localized to mitochondria, consistent with its classification as a mitochondrial protein .

What is the complete amino acid sequence of AtMg00910?

The full amino acid sequence of AtMg00910 is: MPTANQLIRHGREEKRRTDRTEVLVFGLLVTRIIRFVHSVLFPIPVFCSIKVLLDYFCSLPIIDKLSKKWQLIWFYVLSVILCKSLFAVGYLWMDDLSRAISQFYPVVSGGLGGGNTPMPPTNPSEGGLLEGYYAHENEHSHDQQRGSPFWSKEYKESGSKRLFLNLEVEDQNTDTIGEQVKAESGKCEKIKAKIIAKTHELLVSEDTKFQIKTI .

Has the 3D structure of AtMg00910 been determined?

Unlike some proteins such as threonine synthase from Arabidopsis (aTS) which has been crystallized and its structure resolved to 0.28 nm resolution , the 3D structure of AtMg00910 has not yet been fully characterized. Crystallization studies similar to those performed for aTS would be required to determine its structure.

What is the known biological function of AtMg00910?

Research from Kiel University indicates that AtMg00910 is part of the mitochondrial ribosomes and is involved in protein biosynthesis. When artificially switched off, Arabidopsis exhibits delayed and dwarfed growth, suggesting this protein plays a crucial role in plant development, though the exact mechanism remains unknown .

What are the recommended storage and handling conditions for recombinant AtMg00910?

Recombinant AtMg00910 should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles. For working solutions, store aliquots at 4°C for up to one week. The protein is typically supplied as a lyophilized powder in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

How should recombinant AtMg00910 be reconstituted for experimental use?

It is recommended to briefly centrifuge the vial prior to opening to bring contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) is recommended for long-term storage at -20°C/-80°C .

Which techniques are most appropriate for studying AtMg00910 function?

Based on related research, several approaches could be valuable:

• CRISPR-Cas9 gene editing techniques as demonstrated in other Arabidopsis studies could be used to investigate gene function through targeted modifications .

• Protein-protein interaction studies to identify binding partners within the mitochondrial ribosome.

• Comparative analysis approaches similar to those used for threonine synthase, which revealed regulatory properties by comparing plant enzymes with bacterial and yeast counterparts .

How can mixed methods research enhance understanding of AtMg00910?

A mixed methods approach, strategically integrating quantitative and qualitative research techniques, would be particularly valuable for studying AtMg00910. Quantitative methods could measure growth parameters in wild-type versus AtMg00910-deficient plants, while qualitative methods might include subcellular localization studies and protein interaction network analyses .

Are there homologs of AtMg00910 in other organisms?

While specific homologs are not directly identified in the available research, comparative genomics approaches could be employed to identify potential homologs in other plant species. The techniques for targeted inter-homolog recombination described for Arabidopsis could facilitate such comparative analyses .

How does AtMg00910 compare to similar mitochondrial proteins in other plants?

Similar to the comparative analysis performed with threonine synthase (which revealed unique properties of the Arabidopsis enzyme compared to E. coli and yeast counterparts), studies could examine functional differences between AtMg00910 and related proteins in other species . Such analysis might reveal plant-specific adaptations in mitochondrial protein synthesis.

What are promising approaches for further characterizing AtMg00910?

Several promising research directions include:

• Structural studies using X-ray crystallography or cryo-electron microscopy to determine the 3D structure, similar to the approach used for threonine synthase .

• Targeted recombination studies using CRISPR-Cas9 to create specific modifications and observe phenotypic effects .

• Ribosome profiling to understand how AtMg00910 affects mitochondrial translation.

• Metabolomic profiling to identify downstream effects of AtMg00910 deficiency on plant metabolism.