Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg01020 (AtMg01020)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify it; we will prioritize its use.
Synonyms
AtMg01020; Uncharacterized mitochondrial protein AtMg01020; ORF153b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
AtMg01020
Target Protein Sequence
MKNMVRLLLPLLGALAGSFCARFLGSEGSAIMTTTRVSFSSILVVSFLFCFHFHSFRLKG PQKKIIYLFLVFSMGFVGSLIRIEVIHLVGGLALPVLGPLVLNAIGGQALPSTGPSGSGS SSMWEEDSFELGVLEESDSPPAGGPERKRGNPR
Uniprot No.

Target Background

Database Links

KEGG: ath:ArthMp089

STRING: 3702.ATMG01020.1

UniGene: At.48436

Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.