Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg01230 (AtMg01230)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. To ensure a specific tag, please inform us during your order placement; we will prioritize your request.
Synonyms
AtMg01230; At2g07697; Uncharacterized mitochondrial protein AtMg01230; ORF145b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
AtMg01230;
Target Protein Sequence
MWSYEGKCGFLLLSVYKEQVLDSYSPLTKENGISSNPRYIKRKFPFDSGFPFTRKLPAKV ESFLCLPLFLSFLVANLILWLSFHSARVGHQKLSYHLLEWKAFPSSFRNKESKATCDLSS WSNPYFKRKAQIPFSFSRYLLKYLF
Uniprot No.

Target Background

Database Links
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is AtMg01230 and where is it encoded in Arabidopsis thaliana?

AtMg01230 is an uncharacterized mitochondrial protein encoded in the mitochondrial genome of Arabidopsis thaliana. Unlike many mitochondrial proteins that are encoded by nuclear genes and imported into mitochondria, AtMg01230 belongs to the small subset of proteins directly encoded by the mitochondrial DNA. The mitochondrial genome of Arabidopsis contains approximately 57 genes, encoding a limited number of proteins primarily involved in electron transport, ATP synthesis, and mitochondrial translation . AtMg01230 represents one of the proteins whose function remains to be elucidated, despite its conservation in the mitochondrial genome, suggesting its potential importance in mitochondrial function.

How does AtMg01230 compare to other uncharacterized mitochondrial proteins in Arabidopsis?

AtMg01230 is one of several uncharacterized mitochondrial proteins in Arabidopsis. Comprehensive proteomic analysis of Arabidopsis mitochondria has identified approximately 416 proteins, with nearly 20% being proteins of unknown function . This significant proportion of uncharacterized proteins suggests numerous undiscovered mitochondrial functions in plants. AtMg01230 is distinctive in being mitochondrially encoded, while most mitochondrial proteins (including many uncharacterized ones) are nuclear-encoded. Comparative analysis with other uncharacterized mitochondrial proteins like AtMg00470 shows similar challenges in functional annotation .

What expression patterns does AtMg01230 exhibit in different tissues and developmental stages?

The expression of AtMg01230, like other mitochondrially encoded genes in Arabidopsis, shows tissue-specific and developmental regulation patterns. Mitochondrial transcriptome analysis reveals that mitochondrial genes in Arabidopsis display differential expression across tissues and developmental stages . Unlike animal mitochondrial genes which are often transcribed as polycistronic units, many plant mitochondrial genes, potentially including AtMg01230, are transcribed as mono- or bicistronic transcripts . Evidence from studies on mitochondrial transcription suggests that expression is regulated by nuclear-encoded factors, including members of the mTERF (mitochondrial transcription termination factor) family . The specific expression pattern of AtMg01230 would require targeted RNA-seq analysis or RT-qPCR quantification across different tissues and developmental stages.

What are the most effective protocols for isolating pure mitochondria from Arabidopsis to study AtMg01230?

For high-purity mitochondrial isolation from Arabidopsis essential for studying AtMg01230, researchers should employ a two-step Percoll gradient centrifugation method:

  • Initial preparation: Harvest Arabidopsis tissue (cell culture is often preferred for higher yields) and homogenize in isolation buffer containing 0.3 M sucrose, 25 mM tetrasodium pyrophosphate, 2 mM EDTA, 10 mM KH₂PO₄, 1% PVP-40, 1% BSA, 20 mM ascorbic acid, pH 7.5 .

  • Differential centrifugation: Perform sequential centrifugation steps (1,000g for 5 min to remove debris, followed by 12,000g for 15 min to pellet mitochondria).

  • Percoll purification: Resuspend the crude mitochondrial pellet and layer onto a discontinuous Percoll gradient (18%, 23%, and 40% Percoll) and centrifuge at 40,000g for 45 min .

  • Mitochondrial fraction collection: Carefully collect the mitochondrial fraction at the 23%/40% interface, which typically contains highly purified mitochondria with minimal contamination from other organelles.

  • Purity verification: Assess mitochondrial purity using marker enzyme assays for potential contaminants: cytochrome c oxidase (mitochondrial marker), catalase (peroxisomal marker), and Rubisco activity (chloroplast marker) .

When implemented correctly, this protocol yields mitochondrial preparations with less than 0.2% peroxisomal contamination and approximately 1.5% plastid contamination on a protein basis , making the samples suitable for detailed proteomic analysis of AtMg01230.

How can researchers express and purify recombinant AtMg01230 for in vitro studies?

Effective expression and purification of recombinant AtMg01230 for in vitro studies requires a specialized approach due to its mitochondrial origin:

Expression systems options:

Expression SystemAdvantagesLimitationsRelevant Modifications
E. coliHigh yield, rapid growthPotential folding issues with mitochondrial proteinsCodon optimization, addition of solubility tags (MBP, SUMO)
Yeast (S. cerevisiae)Eukaryotic processing, potential for proper foldingLower yield than E. coliMitochondrial targeting sequence removal
Insect cellsComplex eukaryotic processingHigher cost, longer production timeBaculovirus-mediated expression
Plant-based expressionNative environment, proper foldingLower yield, time-consumingAgrobacterium-mediated transient expression

For AtMg01230, a recommended approach involves:

  • Gene optimization: Synthesize a codon-optimized version of AtMg01230 without its native mitochondrial targeting sequence to improve expression.

  • Vector construction: Clone the optimized sequence into an expression vector with an N-terminal His-tag or other affinity tag for purification purposes.

  • Expression in E. coli: Transform into an E. coli strain optimized for membrane/mitochondrial protein expression (such as C41/C43 or Rosetta-gami strains) and induce with IPTG at lower temperatures (16-20°C) to improve folding.

  • Alternative approach: If bacterial expression fails, use Agrobacterium-mediated transient expression in Nicotiana benthamiana leaves using the "floral dip" method adapted for leaves .

  • Purification: Extract using mild detergents (DDM, LDAO) followed by affinity chromatography and size-exclusion chromatography to obtain pure protein.

This strategic approach balances yield requirements with the need for proper folding of this mitochondrial protein.

What mass spectrometry methods are optimal for characterizing AtMg01230 and its potential modifications?

For comprehensive characterization of AtMg01230 and its modifications, advanced mass spectrometry approaches that integrate multiple techniques are essential:

  • Sample preparation optimization:

    • Perform in-gel digestion using multiple proteases (trypsin, chymotrypsin, and Glu-C) to maximize sequence coverage

    • Implement FASP (Filter-Aided Sample Preparation) for membrane-associated proteins

    • Use titanium dioxide enrichment for phosphopeptides if studying phosphorylation states

  • LC-MS/MS methodology:

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) using nano-HPLC coupled to a high-resolution mass spectrometer (Q-Exactive or Orbitrap instruments) has proven highly effective for mitochondrial proteins in Arabidopsis

    • Implement data-dependent acquisition (DDA) for discovery experiments

    • Use parallel reaction monitoring (PRM) for targeted validation of specific peptides

  • Specialized approaches for PTM detection:

    • Electron transfer dissociation (ETD) fragmentation for preserving labile modifications

    • Neutral loss scanning for detecting phosphorylation events

    • Custom database searches allowing for plant-specific modifications

Research on Arabidopsis mitochondrial proteins demonstrates that LC-MS/MS can identify over 400 proteins from purified mitochondria, including low-abundance proteins like transcription factors and signaling components . When applied specifically to AtMg01230, these techniques can provide:

  • Complete protein sequence verification

  • Identification of post-translational modifications

  • Quantification of protein abundance in different conditions

  • Characterization of potential processing events specific to mitochondrially-encoded proteins

The methods should be adjusted based on specific research questions about AtMg01230, with particular attention to detergent compatibility during sample preparation for this mitochondrial protein.

What bioinformatic strategies can predict the function of uncharacterized proteins like AtMg01230?

Comprehensive functional prediction for AtMg01230 requires integration of multiple bioinformatic approaches:

  • Sequence-based analysis:

    • BLAST and PSI-BLAST searches against multiple databases (UniProt, NCBI nr)

    • Profile-based searches using HMMER against Pfam, SMART, and CDD databases

    • Identification of conserved sequence motifs through MEME and GLAM2

  • Structural prediction and analysis:

    • Ab initio structure prediction using AlphaFold2 or RoseTTAFold

    • Structure comparison using DALI and TM-align to identify structural homologs

    • Binding site prediction through SiteMap or COACH

  • Evolutionary analysis:

    • Construction of phylogenetic trees with related sequences

    • Analysis of evolutionary rate and conservation patterns

    • Identification of co-evolving residues using methods like PSICOV or EVcouplings

  • Integrated approaches:

    • Analysis of genomic context and gene neighborhoods

    • Protein-protein interaction predictions using STRING database

    • Co-expression network analysis with known mitochondrial proteins

For uncharacterized proteins, combining multiple prediction methods significantly increases confidence in functional annotations. Studies of hypothetical proteins have demonstrated that this integrated approach can successfully assign functions to previously uncharacterized proteins with approximately 83% accuracy . For mitochondrial proteins specifically, comparative analysis with yeast and human mitochondrial proteomes can provide additional functional insights through orthology mapping .

When applying these methods to AtMg01230, special attention should be given to mitochondria-specific functions and integration of plant-specific databases and knowledge to enhance prediction accuracy.

How can researchers generate and analyze knockout or overexpression lines for AtMg01230?

Creating knockout or overexpression lines for mitochondrially-encoded genes like AtMg01230 presents unique challenges compared to nuclear genes. Here's a comprehensive strategy:

For knockout/knockdown approaches:

  • TALEN or CRISPR-based mitochondrial genome editing:

    • Design mitochondria-targeted TALEN or CRISPR constructs with mitochondrial localization sequences

    • Optimize codon usage for mitochondrial expression

    • Screen for heteroplasmic and homoplasmic mutations using high-throughput sequencing

  • RNA interference (RNAi) approach:

    • Design constructs targeting AtMg01230 transcripts

    • Express using strong promoters like 35S

    • Include mitochondrial targeting sequences for the RNAi machinery

  • Transplastomic approach (indirect):

    • Express inhibitory RNA or protein from the chloroplast genome

    • Target factors that specifically regulate AtMg01230 expression

For overexpression approaches:

  • Nuclear transformation with mitochondria-targeted construct:

    • Clone AtMg01230 into expression vectors with strong promoters

    • Include efficient mitochondrial targeting sequence

    • Transform Arabidopsis using the floral dip method

  • Inducible expression systems:

    • Use estradiol or dexamethasone-inducible promoters

    • Allow temporal control of expression

Analysis methods for transformed lines:

  • Molecular characterization:

    • RT-qPCR to quantify AtMg01230 transcript levels

    • Western blot with specific antibodies to confirm protein levels

    • NGS to assess mitochondrial genome modification efficiency

  • Phenotypic analysis:

    • Growth measurements under normal and stress conditions

    • Mitochondrial function assays (oxygen consumption, ATP production)

    • Metabolomic analysis to identify affected metabolic pathways

  • Omics integration:

    • Transcriptomics to identify affected nuclear and mitochondrial genes

    • Proteomics to detect changes in mitochondrial protein composition

    • Metabolomics to identify altered metabolic profiles

When evaluating phenotypes, researchers should implement proper experimental design with multiple independent transgenic lines and appropriate statistical analysis, as exemplified in Arabidopsis studies examining genotype effects .

What techniques can determine protein-protein interactions involving AtMg01230?

To comprehensively characterize protein-protein interactions (PPIs) involving AtMg01230, researchers should employ multiple complementary approaches:

In vivo approaches:

  • Co-immunoprecipitation (Co-IP) with mass spectrometry:

    • Generate antibodies against AtMg01230 or use epitope-tagged versions

    • Perform Co-IP from isolated mitochondria under native conditions

    • Identify interacting proteins through LC-MS/MS

    • Validate key interactions with reverse Co-IP experiments

  • Proximity-dependent biotin labeling (BioID or TurboID):

    • Create fusion proteins between AtMg01230 and biotin ligase

    • Express in Arabidopsis with mitochondrial targeting

    • Purify biotinylated proteins and identify via mass spectrometry

    • This approach is particularly valuable for capturing transient interactions

  • Split-fluorescent protein complementation:

    • Create fusions between AtMg01230 and one half of a fluorescent protein

    • Create fusions between candidate interactors and the complementary half

    • Co-express in protoplasts or stable transgenic lines

    • Visualize interactions through fluorescence microscopy

In vitro approaches:

  • Yeast two-hybrid (Y2H) screening:

    • Use AtMg01230 as bait against Arabidopsis cDNA library

    • Focus on mitochondrial protein libraries if available

    • Validate using targeted Y2H for specific candidate interactions

  • Protein microarrays:

    • Print purified AtMg01230 on microarrays

    • Probe with labeled mitochondrial protein extracts

    • Identify interactions through fluorescence detection

Computational predictions:

  • Spectral correlation analysis:

    • Analyze proteome variation patterns across conditions

    • Identify proteins with correlated abundance profiles

    • This approach has been successful in defining hierarchical protein interaction networks

For mitochondrial proteins specifically, the optimal approach combines affinity purification with quantitative proteomics, as this allows detection of intact complexes under near-native conditions. Researchers should be aware that traditional Y2H systems may be less effective for mitochondrial membrane proteins, and specialized split-ubiquitin Y2H systems may provide better results.

How does mitochondrial gene expression coordination impact studies of AtMg01230?

Research on AtMg01230 must consider the complex coordination between nuclear and mitochondrial genomes, which significantly impacts experimental design and interpretation:

  • Anterograde and retrograde signaling impact:

    • Nuclear-encoded factors regulate mitochondrial gene expression through anterograde signaling

    • Mitochondrial status influences nuclear gene expression through retrograde signaling

    • Both pathways must be considered when manipulating AtMg01230 expression

  • Developmental and environmental modulation:

    • Mitochondrial biogenesis in Arabidopsis varies significantly throughout development and in response to environmental signals

    • Studies of AtMg01230 should control for developmental stage and environmental conditions

    • Cell culture systems with sucrose starvation/refeeding can modulate mitochondrial biogenesis and provide a controlled experimental system

  • Coordination mechanisms:

    • Transcriptional coordination: Nuclear-encoded transcription factors regulate mitochondrial gene expression

    • Post-transcriptional coordination: RNA processing, stability, and translation are regulated by nuclear-encoded factors

    • Post-translational coordination: Import, assembly, and activation of proteins involve both nuclear and mitochondrial components

Studies have demonstrated that sucrose starvation in Arabidopsis cell cultures leads to approximately 48% decrease in mitochondrial number/volume after 48 hours, with recovery to initial levels 72 hours after sucrose readdition . This experimental system provides an excellent model for studying AtMg01230 expression during mitochondrial turnover and biogenesis.

Researchers should implement time-course experiments capturing both transcript and protein levels of AtMg01230 during modulated mitochondrial biogenesis to understand its regulation and potential role in this process.

What evolutionary insights can be gained from comparative analysis of AtMg01230 across plant species?

Evolutionary analysis of AtMg01230 across plant species offers crucial insights into its conservation, functional importance, and potential role:

  • Sequence conservation patterns:

    • Perform multi-species alignment of AtMg01230 homologs across diverse plant lineages

    • Identify highly conserved domains and residues, which often correlate with functional importance

    • Analyze selection pressures using dN/dS ratios to identify regions under purifying or positive selection

  • Synteny and genomic context:

    • Compare the genomic neighborhood of AtMg01230 across plant mitochondrial genomes

    • Investigate co-evolution with interacting partners

    • Analyze conserved gene clusters which might indicate functional relationships

  • Comparative expression analysis:

    • Examine expression patterns of AtMg01230 homologs in other species

    • Identify conserved regulatory elements in promoter regions

    • Compare responses to environmental stresses across species

  • Phylogenetic profiling:

    • Construct presence/absence matrices across species

    • Correlate with specific plant traits or environmental adaptations

    • Identify co-evolving gene families

Mitochondrial genomes in plants show unique evolutionary dynamics compared to animals, with significant variation in gene content, genome size, and organization across plant lineages. Research indicates that certain mitochondrial proteins in Arabidopsis show greater similarity to vertebrate homologs than to yeast counterparts , suggesting that evolutionary comparisons should include diverse plant species along with animal models.

The analysis should particularly focus on comparing AtMg01230 between Arabidopsis thaliana and Brassica oleracea (cauliflower), as both represent key Brassicaceae species with well-characterized mitochondrial transcriptomes , allowing for insights into evolutionary conservation within this plant family.

What strategies can resolve contradictory data in functional studies of AtMg01230?

When confronted with contradictory results in AtMg01230 functional studies, researchers should implement a systematic troubleshooting and validation framework:

  • Experimental design evaluation:

    • Reassess genetic background consistency across experiments

    • Evaluate environmental condition standardization

    • Implement factorial designs to identify interaction effects between variables

    • Use appropriate statistical methods for data analysis, considering random and fixed effects

  • Multi-level validation approach:

    • Confirm findings at genomic, transcriptomic, proteomic, and phenotypic levels

    • Use independent methodologies to verify key results

    • Employ both gain-of-function and loss-of-function approaches

    • Validate in multiple genetic backgrounds or ecotypes

  • Integration of contradictory data:

    • Develop testable hypotheses to explain apparent contradictions

    • Consider conditional functionality dependent on specific factors

    • Evaluate tissue-specific or developmental stage-specific effects

    • Assess potential compensatory mechanisms that might mask phenotypes

  • Technical considerations:

    • Standardize protein extraction protocols for mitochondrial proteins

    • Validate antibody specificity through appropriate controls

    • Consider heteroplasmy effects in mitochondrial genome manipulations

    • Account for post-translational modifications that may affect function

Research on Arabidopsis genetic variation demonstrates significant differences in transcript abundance between ecotypes, with 27-37.5% of genes showing additive genetic effects in expression between different accessions . This natural variation should be considered when comparing results across different Arabidopsis backgrounds.

For definitive functional characterization, researchers should combine reverse genetics approaches with biochemical assays and consider developing an in vitro reconstitution system to directly test hypothesized molecular functions of AtMg01230.

How can researchers address challenges in functional annotation of uncharacterized mitochondrial proteins like AtMg01230?

Addressing the challenges in functional annotation of AtMg01230 requires an integrated strategy that combines multiple approaches:

  • Integrative omics approach:

    • Correlate transcriptomic, proteomic, and metabolomic data across conditions

    • Identify co-expression networks to place AtMg01230 in functional modules

    • Use spatial and temporal expression patterns to infer potential functions

    • Implement machine learning algorithms to integrate diverse data types

  • Domain-based function prediction refinement:

    • Perform detailed domain analysis beyond standard database searches

    • Identify cryptic or non-canonical functional motifs

    • Use structure prediction to identify potential ligand-binding sites

    • Analyze conserved surface patches as potential interaction interfaces

  • Systematic phenotyping approach:

    • Develop a phenotyping matrix covering diverse conditions (temperature, light, nutrients)

    • Implement high-throughput stress assays (oxidative, osmotic, pH)

    • Analyze mitochondrial function parameters (membrane potential, ROS production)

    • Measure metabolic outputs under various conditions

  • Targeted functional assays:

    • Design biochemical assays based on predicted functions

    • Test interaction with known mitochondrial complexes

    • Assess impact on mitochondrial transcript processing or stability

    • Evaluate potential roles in mitochondrial DNA maintenance

Functional annotation studies of uncharacterized proteins have demonstrated that integration of multiple prediction methods can successfully assign functions with approximately 83.6% accuracy . For mitochondrial proteins specifically, large-scale proteomic studies have revealed that approximately 20% of identified mitochondrial proteins in Arabidopsis have unknown functions , highlighting both the challenge and opportunity in this research area.

When implementing this strategy for AtMg01230, researchers should pay particular attention to mitochondria-specific processes such as organellar gene expression, electron transport chain assembly, and coordination with nuclear gene expression.

What are the most promising research directions for understanding AtMg01230 function?

Based on current knowledge and methodological advances, the most promising research directions for elucidating AtMg01230 function include:

  • Mitochondrial transcriptome regulation: Investigating potential roles in RNA processing, stability, or translation within plant mitochondria, building on findings that plant mitochondrial genes are often transcribed as mono- or bicistronic units with complex post-transcriptional regulation .

  • Stress response modulation: Examining AtMg01230 expression and function under various biotic and abiotic stresses, similar to studies of other mitochondrial proteins like AtMTM1 which showed specific induction by paraquat but not hydrogen peroxide .

  • Protein-protein interaction network mapping: Determining the interaction partners of AtMg01230 to place it within the functional context of the mitochondrial proteome, following successful approaches used for other mitochondrial proteins .

  • Evolutionary functional conservation: Comparing AtMg01230 function across plant species to identify conserved roles, particularly focusing on comparisons between Arabidopsis thaliana and Brassica oleracea as key Brassicaceae species .

  • Integration with nuclear gene expression: Exploring potential roles in nuclear-mitochondrial communication pathways, building on established frameworks for studying this coordination .

These directions leverage the extensive methodological toolkit now available for studying plant mitochondrial proteins while focusing on the unique aspects of plant mitochondrial biology that distinguish it from other eukaryotic systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.