Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg01350 (AtMg01350)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Arabidopsis thaliana Uncharacterized Mitochondrial Protein AtMg01350 (AtMg01350)

Recombinant Arabidopsis thaliana Uncharacterized Mitochondrial Protein AtMg01350 (AtMg01350) is a bioengineered protein derived from the model plant Arabidopsis thaliana. The protein is produced via recombinant expression in E. coli (or other systems like yeast or mammalian cells) and is fused to an N-terminal His tag for purification and detection purposes . Its full-length sequence spans 145 amino acids (1–145aa), with a molecular weight not explicitly stated in available sources .

ParameterSpecification
UniProt IDP92564
Gene NameAtMg01350
SynonymsORF145c
Source OrganismArabidopsis thaliana (Mouse-ear cress)
Expression HostE. coli , Yeast , Mammalian cells
TagN-terminal His tag ; AviTag Biotinylated (in some variants)
Protein LengthFull length (1–145aa)
Purity>90% (SDS-PAGE validated)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0

Expression Systems and Purification

The protein is primarily produced in E. coli, though alternative expression systems (e.g., yeast, mammalian cells) are available for specialized applications . The His tag facilitates affinity chromatography purification, enabling high yields and specificity .

Expression SystemAdvantagesApplications
E. coliCost-effective, rapid production, scalableBasic research, SDS-PAGE, ELISA
YeastProper disulfide bond formationStructural studies
Mammalian cellsPost-translational modificationsFunctional assays

Current Research Gaps

Despite its availability as a recombinant protein, AtMg01350 remains poorly characterized in terms of biological function. Available sources indicate no published studies on its:

  • Pathway involvement: No documented pathways in databases like KEGG or STRING .

  • Interactions: No reported protein-protein or protein-molecule interactions .

  • Functional roles: No experimental evidence linking it to mitochondrial processes (e.g., electron transport, ATP synthesis) .

Potential Research Directions

Given the lack of functional data, future studies could explore:

  1. Localization studies: Confirm mitochondrial targeting using GFP-tagged constructs.

  2. Proteomic interactions: Co-IP or yeast two-hybrid assays to identify binding partners.

  3. Functional assays: Knockout/knockdown experiments in Arabidopsis to assess phenotypic effects.

Applications in Research

  • SDS-PAGE: Used as a control or marker in electrophoresis workflows .

  • ELISA: Biotinylated AviTag variants enable antibody-based detection .

  • Structural studies: Yeast/mammalian-expressed forms may aid crystallography .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AtMg01350; Uncharacterized mitochondrial protein AtMg01350; ORF145c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
AtMg01350
Target Protein Sequence
MTKREYNSQPEMKEEVLAYLLQLSASLVLPVAIWLIAAGQIFTCLRGYTISNYQEKVEEK LCSTLVDKISEKLADLFPVYGITPSRNAPFPTILEQLLATVSQEERLAYLSNMYNSLIEM GIDSPCFYPIVQTFLFLMGGGGGPA
Uniprot No.

Target Background

Database Links
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

How is recombinant AtMg01350 protein typically prepared for research applications?

Recombinant AtMg01350 protein is typically prepared by expressing the full-length sequence (145 amino acids) in E. coli expression systems with an N-terminal His-tag for purification purposes . The protein is purified to >90% purity as determined by SDS-PAGE and is commercially available in lyophilized powder form .

For proper handling, it's recommended to:

  • Briefly centrifuge the vial before opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50%) for long-term storage

  • Aliquot to avoid repeated freeze-thaw cycles

  • Store at -20°C/-80°C

The storage buffer typically contains Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain protein stability during storage .

What are the recommended applications for AtMg01350 antibodies in plant mitochondrial research?

AtMg01350 antibodies are primarily developed for research applications including Western blotting (WB) and ELISA . When conducting Western blot analysis with these antibodies, researchers should consider the following methodological approach:

  • Sample preparation: Extract plant mitochondrial proteins using specialized buffers that preserve membrane protein integrity (typically containing non-ionic detergents)

  • Protein separation: Use SDS-PAGE with 12-15% gels to effectively resolve this relatively small protein

  • Transfer conditions: Optimize transfer parameters for hydrophobic mitochondrial proteins (using PVDF membranes rather than nitrocellulose)

  • Blocking: Use 3-5% BSA in TBS-T rather than milk-based blockers to reduce background

  • Primary antibody dilution: Start with 1:500 to 1:2000 dilution depending on antibody concentration

  • Detection: Use enhanced chemiluminescence with appropriate HRP-conjugated secondary antibodies

The polyclonal antibodies against AtMg01350 are typically raised in rabbits using recombinant Arabidopsis thaliana AtMg01350 protein as the immunogen . These antibodies are affinity-purified and supplied in a buffer containing 50% glycerol, 0.01M PBS (pH 7.4), and 0.03% Proclin 300 as a preservative .

What are the best methods for studying AtMg01350 expression changes in response to environmental stresses?

Based on gene expression studies, AtMg01350 shows significant expression changes in response to environmental stresses, particularly UV-C light exposure . To effectively study such changes, researchers should consider the following methodological approaches:

  • RNA-Seq analysis: This provides comprehensive transcriptome analysis with the following protocol considerations:

    • Extract high-quality RNA using specialized plant RNA extraction kits

    • Prepare RNA-Seq libraries with rRNA depletion (rather than poly-A selection) to capture mitochondrial transcripts

    • Sequence at sufficient depth (>20M reads per sample)

    • Analyze using differential expression software like DESeq2

  • qRT-PCR validation: For targeted expression analysis with the following considerations:

    • Design primers specific to AtMg01350 with attention to any sequence homology with nuclear genes

    • Select appropriate reference genes stable under the experimental conditions

    • Use both biological (minimum 3) and technical replicates (minimum 3)

When analyzing differential expression data, researchers should look for statistical significance as shown in this example from a DESeq2 analysis:

Gene IDBase MeanLog2FoldChangeStandard ErrorStatp-valuepadj
ATMG0135011.614623-1.47656960.5731928-2.57604379.993801e-035.694126e-09

This data shows significant downregulation (log2FC = -1.48) with a highly significant adjusted p-value .

How does AtMg01350 expression respond to UV stress, and what does this suggest about its function?

Research comparing UV-C light exposure effects on Arabidopsis thaliana has revealed significant insights into AtMg01350 expression patterns. In a comparative study of 1-second flash versus 60-second UV-C exposures, AtMg01350 was consistently upregulated in response to the flash treatment . This response pattern was shared among all 45 identified mitochondrial genes (ATMG genes) in the flash treatment, while only 14 of these genes showed upregulation in the 60-second treatment .

The consistent upregulation of AtMg01350 and other mitochondrial genes suggests:

  • A direct stimulating effect of UV-C light on mitochondrial activities

  • A potential role for AtMg01350 in stress response mechanisms

  • Possible involvement in mitochondrial electron transport pathways, as 52 differentially expressed genes (DEGs) were involved in this pathway after flash treatment

The absence of downregulated genes among the mitochondrial genome genes (ATMG) in both treatments further supports their role in the cellular stress response mechanisms . This pattern suggests AtMg01350 may function in energy metabolism adaptation during acute stress responses.

What techniques are recommended for investigating protein-protein interactions involving AtMg01350?

Given that AtMg01350 is an uncharacterized mitochondrial protein, investigating its protein-protein interactions is crucial for understanding its functional role. Based on current research methodologies, the following techniques are recommended:

  • Yeast Two-Hybrid (Y2H) screening:

    • Clone the full-length AtMg01350 sequence into a bait vector

    • Screen against an Arabidopsis cDNA library

    • Verify positive interactions with targeted confirmation assays

    • Note: This approach may have limitations for membrane-associated proteins

  • Co-immunoprecipitation (Co-IP) with mass spectrometry:

    • Express tagged versions of AtMg01350 in Arabidopsis or cell culture systems

    • Use anti-tag antibodies for precipitation

    • Analyze co-precipitated proteins by mass spectrometry

    • Validate interactions with targeted Western blotting

  • Proximity-dependent biotin identification (BioID):

    • Generate a fusion construct of AtMg01350 with a biotin ligase (BirA*)

    • Express in plant systems and allow in vivo biotinylation of proximal proteins

    • Purify biotinylated proteins and identify by mass spectrometry

    • This method is particularly valuable for identifying transient or weak interactions

  • Split-fluorescent protein complementation:

    • Create fusion constructs with split YFP or GFP fragments

    • Co-express with candidate interacting proteins

    • Visualize interactions through confocal microscopy

    • This approach provides spatial information about where interactions occur

The interacting proteins identified through these methods can provide valuable insights into the functional networks and pathways involving AtMg01350 .

How can gene editing approaches be used to study the functional significance of AtMg01350?

Investigating the function of mitochondrial-encoded genes presents unique challenges compared to nuclear genes. For AtMg01350, researchers can employ several approaches:

  • Mitochondrial transformation techniques:

    • While challenging in plants, new approaches using biolistics with mitochondria-targeted vectors are being developed

    • Target expression vectors to mitochondria using mitochondrial targeting sequences

    • Verify transformation using fluorescent markers and PCR validation

  • CRISPR/Cas9 adaptation for mitochondrial genomes:

    • Recent advances with mitochondria-targeted CRISPR systems offer new possibilities

    • Design guide RNAs specific to AtMg01350 sequences

    • Use mitochondrial-targeted Cas9 with appropriate targeting sequences

    • Confirm editing using deep sequencing of mitochondrial DNA

  • RNA interference (RNAi) approaches:

    • Design constructs to produce double-stranded RNA matching AtMg01350 sequence

    • Express these constructs with mitochondrial targeting sequences

    • Verify knockdown using qRT-PCR and Western blotting

    • Assess phenotypic changes in response to stressors like UV light

  • Overexpression studies:

    • Generate constructs for mitochondrial expression of AtMg01350

    • Analyze changes in mitochondrial function and stress responses

    • Monitor electron transport chain activity and ATP production

For all approaches, researchers should include appropriate controls and validate changes in AtMg01350 expression at both RNA and protein levels. Phenotypic assessments should include mitochondrial function parameters, stress response measurements, and growth/development analyses under different conditions .

What approaches can resolve discrepancies in AtMg01350 expression data between different experimental conditions?

Researchers sometimes encounter contradictory expression data for AtMg01350 across different studies or experimental conditions. For example, in one study comparing different stress conditions, a researcher noted: "I get almost the same results between these 2 comparisons whereas I guess it should be very different (control vs stress)" . To address such discrepancies, consider the following analytical approaches:

  • Experimental design re-evaluation:

    • Examine the experimental conditions carefully (timing, intensity of stressors)

    • Consider biological variables (plant age, growth conditions, ecotype differences)

    • Evaluate the statistical models used in differential expression analysis

  • Normalization method assessment:

    • Different normalization methods in RNA-Seq can affect results

    • Compare multiple normalization approaches (e.g., TPM, RPKM, DESeq2 normalization)

    • Use spike-in controls to validate normalization effectiveness

  • Multi-factorial analysis:

    • Implement DESeq2's multi-factorial design capabilities

    • Use models that account for interaction effects between conditions

    • Check for batch effects and include them in the model

  • Independent validation:

    • Confirm RNA-Seq results with qRT-PCR

    • Use protein-level quantification (Western blotting)

    • Employ different statistical approaches to verify significance

When investigating discrepancies, examining the resultsNames output from DESeq2 (e.g., "Intercept", "condition0h", "condition24h", "condition6h") can help identify how the statistical model was constructed and whether it appropriately captures the experimental design . Additionally, visualizing the data using PCA plots and heatmaps can reveal patterns that may explain unexpected similarities between conditions.

How can AtMg01350 expression patterns be integrated into broader studies of plant mitochondrial responses to environmental stress?

AtMg01350 expression changes in response to environmental stressors provide a valuable marker for mitochondrial adaptation. To integrate these patterns into broader studies:

  • Multi-omics integration approaches:

    • Combine transcriptomics (RNA-Seq) with proteomics and metabolomics

    • Create integrated networks to identify co-regulated pathways

    • Use tools like MapMan to visualize pathway responses, as seen in UV response studies where AtMg01350 was linked to mitochondrial electron transport pathways

  • Comparative analyses across stress types:

    • Design experiments comparing multiple stressors (drought, salt, UV, heat)

    • Identify common and stress-specific response patterns

    • Determine if AtMg01350 shows stress-specific or general stress responses

  • Temporal dynamics assessments:

    • Implement time-course experiments to capture expression kinetics

    • Early vs. late response patterns can reveal functional roles

    • UV-C flash treatments showed immediate upregulation of AtMg01350, suggesting early response functions

  • Cross-species comparative approaches:

    • Identify homologs in other plant species

    • Compare expression patterns and regulatory elements

    • Evaluate evolutionary conservation of stress response mechanisms

In the study of UV-C effects, researchers identified that all 45 mitochondrial genes were upregulated in flash treatment, with 14 also upregulated in 60s treatment, suggesting coordinated mitochondrial responses that include AtMg01350 . This pattern provides valuable context for understanding how this uncharacterized protein fits within broader stress adaptation mechanisms.

What experimental controls should be implemented when studying AtMg01350 in differential expression analyses?

When conducting differential expression studies involving AtMg01350, proper experimental controls are essential for reliable results. Recommended controls include:

  • Biological controls:

    • Include multiple biological replicates (minimum 3-5)

    • Ensure plants are at identical developmental stages

    • Control environmental conditions tightly across all samples

    • Include untreated control groups for each time point to account for circadian effects

  • Technical controls:

    • Include spike-in RNA controls (ERCC or similar) to assess technical variation

    • Process all samples in parallel using identical protocols

    • Include technical replicates for at least a subset of samples

    • Perform sequencing across multiple lanes to control for lane effects

  • Analysis-specific controls:

    • Verify differential expression using multiple algorithms (DESeq2, edgeR, limma)

    • Use appropriate multiple testing correction methods

    • Include housekeeping genes evaluation to validate normalization

    • Examine multiple reference genes when performing qRT-PCR validation

  • Validation controls:

    • Confirm RNA-level changes with protein-level measurements

    • Use multiple methodologies for validation (qRT-PCR, Northern blot, Western blot)

    • Include positive control genes known to respond to the treatment

    • Examine parallel pathways to confirm specificity of responses

These controls help address the challenges observed in studies where researchers found unexpected similarities between different stress conditions, as noted in one analysis: "I get almost the same results between these 2 comparisons whereas I guess it should be very different (control vs stress)" . Properly implemented controls can help resolve such discrepancies and ensure the reliability of AtMg01350 expression data.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.