Recombinant Arabidopsis thaliana Uncharacterized protein At1g01500 (At1g01500)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your preparation.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is finalized during production. If you require a particular tag, please inform us, and we will prioritize its incorporation.
Synonyms
At1g01500; F22L4.17; Uncharacterized protein At1g01500
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At1g01500
Target Protein Sequence
MISKDHLHHLDPLGTTKSYHMNTSTVSPPSPASSISLSQSAWLEVRLFYVRIAPCVVENV PDFLTLRHPRRETGASLEVNGVRVPSSQTASLKLRRDRVDRESSEVTYVSTETVRVTGCV DFEVYDNEDMVLCGNLDRIEGAWNNGTVSDPKTGWGMDCYIAMGNGHVSGPSASVFFQPK FGVSSPSVEVYIAGCCGGVPVILTKTIQASPRRKVARHVTLDAIPEDEEVGKEQDIGTIG DELARQSKVQMMESEVDEYDDSDMKMAQRYYPEGMYVDEDGQLSWFNAGVRVGVGIGLGM CLGVGIGVGLLMRSYQATTSNLRRRFL
Uniprot No.

Target Background

Database Links

KEGG: ath:AT1G01500

UniGene: At.27718

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is At1g01500 and what protein family does it belong to?

At1g01500 is an Arabidopsis thaliana protein classified within the Erythronate-4-phosphate dehydrogenase family. Located on chromosome 1 at position 185260-186573 in the forward direction, this protein consists of 327 amino acids in length . The gene encoding At1g01500 is one of approximately 29,454 predicted genes in the Arabidopsis genome, which has been extensively studied through insertional mutagenesis techniques . As a member of the Erythronate-4-phosphate dehydrogenase family, this protein likely plays a role in carbohydrate metabolism pathways, though many aspects of its specific function remain to be fully characterized.

How has At1g01500 been identified and characterized in genomic studies?

At1g01500 has been identified and characterized primarily through genome-wide insertional mutagenesis studies of Arabidopsis thaliana. Large-scale T-DNA insertion projects have generated more than 225,000 independent insertion events throughout the Arabidopsis genome, with precise locations determined for over 88,000 of these insertions . Through these comprehensive genomic approaches, mutations have been identified in more than 21,700 Arabidopsis genes, including At1g01500 . Genome-wide analysis has revealed interesting patterns in the distribution of these integration events, with significant biases observed at both chromosome and gene levels . When studying At1g01500, researchers typically reference these large-scale genomic resources to understand the gene's context within the broader Arabidopsis genome.

What sequence homology does At1g01500 share with proteins in other plant species?

Sequence analysis indicates that At1g01500 shares homology with proteins in other plant species, as demonstrated by BLAST results showing similarity to transcript comp15365_c0_seq1 in Sesbania sesban with a significant E-value of 8e-30 . The alignment between these sequences has a score of 110, occurring in the +3 reading frame . This level of conservation suggests that At1g01500 likely performs an evolutionarily conserved function across different plant species. When conducting comparative genomic analyses, researchers should consider examining orthologous proteins in other model and non-model plant systems to gain insights into functional conservation and potential specialized roles in different plant lineages.

What expression systems are most suitable for recombinant At1g01500 production?

For recombinant At1g01500 production, researchers have multiple expression system options, each with distinct advantages depending on experimental requirements. Common expression systems include:

Expression SystemAdvantagesConsiderations
E. coli (BL21(DE3), JM115, Rosetta-GAMI)Rapid growth, high yield, cost-effectiveMay lack post-translational modifications
Yeast (SMD1168, GS115, X-33)Eukaryotic modifications, moderate yieldLonger production timeline than bacteria
Insect cells (Sf9, Sf21, High Five)Complex eukaryotic modificationsHigher cost, specialized equipment needed
Mammalian cells (293, 293T, NIH/3T3, COS-7, CHO)Most authentic post-translational modificationsHighest cost, lowest yield, longest timeline

Selection should be based on research needs, with E. coli systems providing efficient production for structural studies, while eukaryotic systems may be preferable when authentic folding and modifications are essential for functional analysis . When expressing plant proteins like At1g01500 in heterologous systems, codon optimization is often necessary to enhance expression levels in the host organism.

How should researchers approach purification of recombinant At1g01500?

Purification of recombinant At1g01500 typically involves a multi-step process designed to maximize yield, purity, and biological activity. The approach should begin with the selection of appropriate fusion tags to facilitate purification. Common options include:

  • Affinity tags: His-tag, FLAG-tag, GST, or MBP fusions

  • Tag positioning: Consider both N-terminal and C-terminal positioning to determine optimal accessibility

  • Purification protocol sequence:

    • Initial capture via affinity chromatography based on the selected tag

    • Secondary purification using ion exchange chromatography

    • Polishing step with size exclusion chromatography for highest purity

For optimal results, researchers should conduct small-scale pilot studies to identify potential solubility issues and optimize buffer conditions before scaling up production . Depending on experimental requirements, additional processing steps such as tag removal, endotoxin removal, and filtration sterilization may be necessary . Quality control should include SDS-PAGE and Western blot analysis to confirm protein identity, purity, and integrity.

What strategies can improve the solubility of recombinant At1g01500?

Enhancing the solubility of recombinant At1g01500 requires systematic optimization of multiple parameters throughout the expression and purification process. Key strategies include:

  • Fusion partner selection: MBP (maltose-binding protein) and thioredoxin (trxA) tags significantly enhance solubility compared to simple His-tags

  • Expression conditions optimization:

    • Reduce induction temperature (16-20°C)

    • Lower inducer concentration

    • Extend expression duration at reduced temperatures

  • Buffer optimization:

    • Screen additives (glycerol, arginine, detergents)

    • Test various pH conditions

    • Include stabilizing agents appropriate for dehydrogenase family proteins

If the protein expresses primarily as inclusion bodies despite optimization efforts, refolding protocols can be implemented to recover soluble, active protein . The refolding process typically involves solubilization of inclusion bodies with denaturants followed by gradual removal of the denaturant through dialysis or dilution while maintaining conditions that prevent aggregation.

How can researchers effectively design insertion mutants targeting At1g01500?

Designing effective insertion mutants for At1g01500 requires strategic planning based on genomic structure and protein domains. Researchers should:

  • Analyze the gene structure to identify critical exons, particularly those encoding functional domains of the Erythronate-4-phosphate dehydrogenase family

  • Reference existing T-DNA insertion collections, which contain mutations in over 21,700 Arabidopsis genes

  • Design insertion strategies targeting:

    • Promoter regions (for expression modulation)

    • Early exons (for complete knockout)

    • Specific domains (for targeted functional disruption)

  • Employ CRISPR-Cas9 approaches for precise modifications when conventional T-DNA insertions are insufficient

When analyzing the resulting mutants, researchers should implement thorough genotyping protocols to confirm insertion positions, followed by RT-PCR and Western blot analyses to verify disruption of transcript and protein expression. Phenotypic characterization should include comprehensive metabolic profiling, focusing on pathways involving erythronate-4-phosphate, as well as general plant development and stress response parameters.

What approaches are recommended for studying protein-protein interactions involving At1g01500?

Investigating protein-protein interactions involving At1g01500 requires a multi-faceted approach combining both in vitro and in vivo techniques to generate comprehensive and reliable interaction data. Recommended methodologies include:

  • Yeast two-hybrid (Y2H) screening:

    • Construct bait plasmids containing At1g01500 fused to DNA-binding domains

    • Screen against Arabidopsis cDNA libraries

    • Validate positive interactions through targeted assays

  • Co-immunoprecipitation (Co-IP) studies:

    • Express tagged versions of At1g01500 in plant tissues

    • Immunoprecipitate protein complexes using tag-specific antibodies

    • Identify co-precipitated proteins via mass spectrometry

  • Bimolecular fluorescence complementation (BiFC):

    • Generate fusion constructs with split fluorescent protein fragments

    • Co-express in plant cells to visualize interactions in native cellular contexts

    • Analyze subcellular localization of interaction complexes

  • Proximity-based labeling approaches:

    • Fuse At1g01500 with enzymes like BioID or APEX2

    • Identify proximal proteins through biotinylation and subsequent purification

    • Distinguish between direct interactors and proteins in the same complex

Each method has specific strengths and limitations, so combining multiple approaches provides the most robust interaction data for functional interpretation.

What structural biology techniques are most suitable for characterizing At1g01500?

Characterizing the structure of At1g01500 presents unique challenges that can be addressed through complementary structural biology approaches:

How should researchers approach enzymatic activity assays for At1g01500?

Designing robust enzymatic activity assays for At1g01500 requires careful consideration of its predicted function as an Erythronate-4-phosphate dehydrogenase family protein. A comprehensive approach should include:

  • Substrate preparation:

    • Synthesize or source pure Erythronate-4-phosphate

    • Prepare related metabolites for specificity testing

    • Include appropriate cofactors (likely NAD+ or NADP+)

  • Assay development:

    • Monitor NAD(P)H formation spectrophotometrically at 340nm

    • Design coupled enzyme assays if direct product detection is challenging

    • Optimize reaction conditions (pH, temperature, buffer composition)

  • Kinetic analysis:

    • Determine Km and Vmax parameters through Michaelis-Menten kinetics

    • Evaluate potential inhibitors and activators

    • Assess substrate specificity using structural analogs

  • Controls and validation:

    • Include enzyme-free and substrate-free controls

    • Test catalytically inactive mutants (generated by site-directed mutagenesis)

    • Compare activity with related enzymes from other organisms

When interpreting results, researchers should consider the possibility that At1g01500 may have evolved substrate specificities that differ from canonical Erythronate-4-phosphate dehydrogenases, potentially indicating specialized metabolic roles in Arabidopsis.

What approaches should be used to investigate the physiological role of At1g01500 in Arabidopsis?

Investigating the physiological role of At1g01500 in Arabidopsis requires a comprehensive phenotypic analysis of plants with altered expression levels, combined with molecular and biochemical characterization:

  • Genetic resources development:

    • Identify and characterize T-DNA insertion lines disrupting At1g01500

    • Generate overexpression lines using constitutive and tissue-specific promoters

    • Create complementation lines to confirm phenotype-genotype relationships

  • Phenotypic analysis across developmental stages:

    • Document growth parameters under standard conditions

    • Assess responses to various abiotic stresses (drought, salt, temperature extremes)

    • Evaluate metabolic profiles using targeted and untargeted metabolomics

  • Gene expression analysis:

    • Determine tissue-specific and developmental expression patterns

    • Identify conditions that regulate At1g01500 expression

    • Perform transcriptome analysis to identify co-regulated genes

  • Subcellular localization:

    • Generate fluorescent protein fusions to determine compartmentalization

    • Perform biochemical fractionation to confirm localization

    • Identify potential organelle-specific functions

Integration of these diverse datasets will provide a comprehensive understanding of At1g01500's role in plant metabolism and development, potentially revealing unexpected functions beyond its predicted enzymatic activity.

How can researchers interpret contradictory results in At1g01500 functional studies?

When encountering contradictory results in At1g01500 functional studies, researchers should implement a systematic approach to resolve discrepancies:

  • Methodological comparison:

    • Rigorously examine differences in experimental protocols

    • Consider genetic background variations in plant materials

    • Evaluate environmental conditions that might influence results

  • Statistical reanalysis:

    • Apply appropriate statistical methods for the specific data types

    • Consider sample size limitations and power analysis

    • Implement more robust statistical approaches when appropriate

  • Independent validation:

    • Use complementary techniques to verify key findings

    • Collaborate with independent laboratories for replications

    • Consider different genetic backgrounds or ecotypes

  • Biological context integration:

    • Evaluate whether contradictions reflect context-dependent functions

    • Consider redundancy with related genes that may mask phenotypes

    • Investigate potential post-transcriptional or post-translational regulation

  • Literature meta-analysis:

    • Systematically compare methodologies across published studies

    • Identify patterns in contradictory findings

    • Develop unifying hypotheses that account for apparently conflicting results

By approaching contradictions as opportunities for deeper investigation rather than obstacles, researchers can develop more nuanced and accurate models of At1g01500 function.

How should researchers design experiments to study At1g01500 regulation?

Designing experiments to study At1g01500 regulation requires a multi-layered approach addressing transcriptional, post-transcriptional, and post-translational mechanisms:

  • Transcriptional regulation:

    • Promoter analysis: Clone the At1g01500 promoter (1-2kb upstream) into reporter constructs

    • Identify transcription factor binding sites through bioinformatic analysis

    • Perform chromatin immunoprecipitation (ChIP) to confirm direct binding

    • Test promoter activity under various conditions and in different tissues

  • Post-transcriptional regulation:

    • Analyze mRNA stability under different conditions

    • Investigate alternative splicing patterns

    • Identify potential regulatory small RNAs through computational prediction and validation

  • Post-translational regulation:

    • Map modification sites (phosphorylation, ubiquitination, etc.) through mass spectrometry

    • Investigate protein turnover rates using cycloheximide chase assays

    • Generate modification-site mutants to assess functional consequences

  • Environmental response profiling:

    • Monitor expression changes in response to hormones, stresses, and developmental cues

    • Correlate protein abundance with transcript levels to identify translational control

    • Integrate data from public repositories to identify conditions affecting At1g01500

This comprehensive approach will reveal the regulatory networks controlling At1g01500 expression and activity, providing insights into its physiological roles and potential biotechnological applications.

What statistical approaches are most appropriate for analyzing At1g01500 experimental data?

The analysis of experimental data relating to At1g01500 requires carefully selected statistical approaches appropriate to the specific experimental design and data characteristics:

  • For gene expression comparisons:

    • Use paired t-tests for before/after comparisons within the same samples

    • Apply ANOVA for multi-condition comparisons with post-hoc tests (Tukey, Bonferroni)

    • Implement non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) when normality cannot be assumed

  • For phenotypic analyses:

    • Perform repeated measures ANOVA for time-course experiments

    • Use mixed-effects models to account for random factors

    • Apply multivariate approaches for correlated phenotypic traits

  • For protein-protein interaction data:

    • Implement statistical filtering to distinguish true interactions from background

    • Use clustering algorithms to identify interaction networks

    • Apply enrichment analyses to characterize interacting proteins functionally

  • For metabolomic studies:

    • Use principal component analysis (PCA) to identify major patterns

    • Apply partial least squares discriminant analysis (PLS-DA) for supervised classification

    • Implement pathway enrichment analysis to contextualize metabolic changes

When designing experiments, researchers should conduct power analyses to determine appropriate sample sizes and include biological replicates (typically n≥3) to ensure robust statistical inference. Publication of complete datasets and transparent reporting of statistical methods enhances reproducibility and facilitates meta-analyses.

How can researchers effectively formulate research questions about At1g01500?

Formulating effective research questions about At1g01500 requires careful consideration of question type, scope, and methodological approach. Well-designed research questions should:

  • Be specific and focused to allow for clear experimental design and interpretation

  • Be relevant to broader biological concepts while remaining precisely targeted to At1g01500

  • Be testable through available methodologies and within practical constraints

  • Avoid simple yes/no answers, instead requiring analytical approaches and data interpretation

Examples of well-formulated research questions for At1g01500 studies include:

Research Question TypeExample Formulation
CorrelationalWhat is the relationship between At1g01500 expression levels and drought tolerance in Arabidopsis?
ExploratoryHow does the interactome of At1g01500 differ between root and shoot tissues?
ExplanatoryWhat mechanisms regulate the enzymatic activity of At1g01500 during phosphate starvation?

The most productive research questions often emerge from preliminary data or observations that suggest unexpected patterns or relationships . Building questions that connect At1g01500 to broader biological processes or that explore its role in responding to environmental challenges can enhance the impact and significance of the research.

What emerging technologies could advance our understanding of At1g01500 function?

Several cutting-edge technologies hold particular promise for advancing our understanding of At1g01500 function:

  • Single-cell transcriptomics and proteomics:

    • Reveal cell-type specific expression patterns

    • Identify rare cell populations where At1g01500 may play critical roles

    • Map expression dynamics during development at unprecedented resolution

  • Genome editing technologies:

    • CRISPR-Cas base editing for precise manipulation without double-strand breaks

    • Prime editing for targeted insertions, deletions, and all possible point mutations

    • Conditional gene regulation systems for temporal and spatial control

  • Structural biology advancements:

    • AlphaFold2 and related AI systems for structure prediction

    • Cryo-electron tomography for in situ structural visualization

    • Integrative structural biology combining multiple experimental approaches

  • Metabolic flux analysis:

    • 13C labeling combined with metabolomics to track carbon flow

    • Flux balance analysis to model metabolic network perturbations

    • Integration with genome-scale metabolic models

  • Systems biology approaches:

    • Multi-omics data integration frameworks

    • Network analysis to position At1g01500 in broader regulatory contexts

    • Machine learning applications for phenotype prediction from molecular data

By applying these emerging technologies to At1g01500 research, scientists can develop more comprehensive and mechanistic understandings of its functions in plant metabolism and physiology.

What are the most significant unanswered questions about At1g01500?

Despite advances in Arabidopsis genomics and proteomics, several fundamental questions about At1g01500 remain unanswered:

  • Physiological substrate specificity:

    • What is the true in vivo substrate of At1g01500 in Arabidopsis?

    • How does substrate preference compare with homologs in other species?

    • Are there secondary enzymatic activities beyond its annotated function?

  • Regulatory networks:

    • What transcription factors directly control At1g01500 expression?

    • How is At1g01500 integrated into stress response pathways?

    • What post-translational modifications regulate its activity?

  • Evolutionary significance:

    • How conserved is At1g01500 function across plant lineages?

    • Has subfunctionalization occurred in species with multiple paralogs?

    • What selective pressures have shaped its evolution?

  • Metabolic integration:

    • How does At1g01500 activity influence broader metabolic networks?

    • What compensatory mechanisms exist when At1g01500 function is compromised?

    • How does its activity coordinate with related metabolic enzymes?

  • Biotechnological potential:

    • Could modulation of At1g01500 enhance plant stress tolerance?

    • Might At1g01500 serve as a target for improving specific plant traits?

    • What industrial applications might utilize At1g01500 enzymatic properties?

Addressing these questions will require integrative approaches combining molecular, biochemical, and systems biology methodologies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.