Recombinant Arabidopsis thaliana Uncharacterized protein At1g08160 (At1g08160)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Information

At1g08160 is annotated as part of the LEA hydroxyproline-rich glycoprotein family, which is typically involved in plant stress responses (e.g., desiccation, salinity) . Key identifiers include:

AttributeDetails
Gene NameAt1g08160
SynonymsT23G18.2, T6D22.24, Uncharacterized protein At1g08160
TAIR Description"Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family"
Uniprot IDQ8VZ13

Functional Data:

  • Pathways: Limited curated data; listed in E. coli expression systems but no explicit pathway associations .

  • Interactions: No confirmed protein interaction partners reported in BioGRID .

Functional Insights and Research Applications

While At1g08160 remains uncharacterized, its LEA family classification suggests potential roles in stress tolerance. Key research applications include:

Gene Expression Studies

DESeq2 data from H3K27me3-marked regions show At1g08160 expression levels:

SampleNormalized CountLog2FoldChangeAdjusted p-value
AT1G08160185.67-0.310.68
Data derived from Life Science Alliance studies .

Recombinant Protein Utilization

Available products enable:

  1. Functional Assays: Study protein interactions or enzymatic activity.

  2. Immunoassays: Rabbit polyclonal antibodies (IgG) for Western blot/ELISA detection .

  3. Structural Studies: His-tagged versions facilitate crystallization or NMR .

Research Gaps and Future Directions

ChallengeOpportunity
Lack of Functional DataPrioritize yeast two-hybrid or co-IP to identify interactors .
Unclear Stress RoleTest desiccation/salt stress responses in A. thaliana knockouts.
Limited Tissue ExpressionProfile At1g08160 in abiotic stress conditions (e.g., drought, cold).

Available Products and Tools

Product TypeSourceKey Features
Full-Length ProteinCreative BioMart His-tagged, >90% purity, E. coli expression.
Partial ProteinMyBioSource Host flexibility (E. coli, yeast, mammalian).
AntibodyMyBioSource Rabbit anti-At1g08160 polyclonal, ELISA/WB use.
ELISA KitCBM15 50 µg recombinant protein, glycerol-stabilized.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is finalized during production. If a particular tag is required, please inform us, and we will prioritize its development.
Synonyms
At1g08160; T23G18.2; T6D22.24; Uncharacterized protein At1g08160
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-221
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At1g08160
Target Protein Sequence
MVPPNPAHQPARRTQPQLQPQSQPRAQPLPGRRMNPVLCIIVALVLLGLLVGLAILITYL TLRPKRLIYTVEAASVQEFAIGNNDDHINAKFSYVIKSYNPEKHVSVRYHSMRISTAHHN QSVAHKNISPFKQRPKNETRIETQLVSHNVALSKFNARDLRAEKSKGTIEMEVYITARVS YKTWIFRSRRRTLKAVCTPVMINVTSSSLDGFQRVLCKTRL
Uniprot No.

Target Background

Database Links

KEGG: ath:AT1G08160

STRING: 3702.AT1G08160.1

UniGene: At.47247

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is At1g08160 and why is it classified as "uncharacterized"?

At1g08160 is a protein from the model plant Arabidopsis thaliana with a full-length sequence of 221 amino acids . It is classified as "uncharacterized" because its specific biological function, three-dimensional structure, and role in cellular pathways have not been experimentally validated. Uncharacterized proteins emerge from genome sequencing projects where open reading frames are identified but their functions remain unknown . The protein is available as a recombinant full-length version with a His-tag expressed in E. coli , which provides researchers with material for functional studies.

What approaches should be used for initial physicochemical characterization of At1g08160?

Initial characterization should include determining key physicochemical parameters using computational and experimental methods. For computational analysis, programs like Expasy's ProtParam can estimate properties based solely on the protein sequence, including:

  • Molecular weight

  • Isoelectric point (pI)

  • Extinction coefficient

  • Grand average of hydropathicity (GRAVY)

  • Instability index

  • Aliphatic index

Negative GRAVY values would indicate hydrophilic nature, while an instability index below 40 would suggest a stable protein . Experimental validation of these properties should follow using techniques such as dynamic light scattering, circular dichroism, and differential scanning calorimetry to assess structural stability under various conditions.

What expression systems are most appropriate for producing recombinant At1g08160?

The choice of expression system depends on research objectives and protein characteristics:

Expression SystemAdvantagesLimitationsBest Applications
E. coli (already demonstrated) High yields, rapid growth, cost-effectiveLimited post-translational modificationsStructural studies, antibody production
Yeast Systems (S. cerevisiae, P. pastoris)Eukaryotic processing, moderate scale-upDifferent glycosylation patterns than plantsProteins requiring some eukaryotic processing
Plant-Based Expression (N. benthamiana, BY-2 cells)Native processing environment, authentic modificationsLower yields, more complex setupFunctional studies requiring plant-specific modifications
Cell-Free SystemsRapid production, handles toxic proteinsHigher cost, smaller scaleInitial screening, difficult-to-express proteins

For At1g08160, the successful E. coli expression with His-tag provides a starting point, but alternative systems should be considered if native plant modifications are required for functional studies.

How should experiments be designed to study the function of At1g08160?

Robust experimental design for At1g08160 research should incorporate:

  • Blocking: Group similar experimental units together to reduce variability, making treatment effects easier to detect .

  • Proper Controls: Include wild-type, empty vector, and unrelated protein controls alongside experimental samples.

  • Randomization: Implement position randomization in growth chambers to minimize position effects .

  • Replication Strategy:

    • Technical replicates: Multiple measurements of the same biological sample

    • Biological replicates: Independent biological samples (minimum 3-5)

    • Consider power analysis to determine appropriate sample sizes

  • Temporal Sampling: For functional studies, measure phenotypes at multiple time points rather than single endpoints, similar to the approach used in Arabidopsis-TuMV studies measuring disease traits daily for 21 days .

  • Environmental Variables: Control and document temperature, light intensity, humidity, and photoperiod precisely as these can significantly affect Arabidopsis protein expression and function.

What methods are most effective for detecting protein-protein interactions involving At1g08160?

To comprehensively identify At1g08160 interaction partners, researchers should employ complementary approaches:

MethodPrincipleAdvantagesLimitations
Yeast Two-Hybrid (Y2H)Binary interaction detection in yeast nucleiHigh-throughput screening capabilityHigh false positive/negative rates, nuclear localization requirement
Co-ImmunoprecipitationAntibody-based pulldown of protein complexesDetects interactions in near-native conditionsRequires antibodies or tags, may disrupt weak interactions
Pull-Down AssaysAffinity-based isolation using His-tagged At1g08160 Can identify direct physical interactionsIn vitro conditions may not reflect in vivo state
BiFC (Bimolecular Fluorescence Complementation)Fluorophore reconstitution when proteins interactVisualizes interactions in plant cells with spatial informationMay stabilize transient interactions, irreversible
Proximity Labeling (BioID)Biotinylation of proximal proteinsCaptures transient and weak interactionsRequires genetic modification, may label non-interacting proximal proteins

The His-tagged recombinant version of At1g08160 provides an immediate resource for pull-down assays, while computational prediction through string analysis can help prioritize candidates for experimental validation .

What strategies should be employed to validate predicted functions of At1g08160?

Function validation requires a systematic approach combining genetic, biochemical, and phenotypic analyses:

  • Genetic Approaches:

    • Generate knockout/knockdown lines via T-DNA insertion or CRISPR-Cas9

    • Create overexpression lines under constitutive and inducible promoters

    • Develop complementation lines to confirm phenotype rescue

  • Biochemical Characterization:

    • Design activity assays based on bioinformatic function predictions

    • Analyze post-translational modifications

    • Determine substrate specificity if enzymatic activity is predicted

  • Phenotypic Analysis Pipeline:

    • Morphological examination under standard growth conditions

    • Response to environmental stressors (drought, salt, temperature)

    • Susceptibility to pathogens using methods similar to those employed in TuMV studies

    • Temporal progression of phenotypes

  • Cellular Localization:

    • Generate fluorescent protein fusions for subcellular localization

    • Confirm with biochemical fractionation and immunoblotting

What bioinformatic pipeline is recommended for predicting the function of At1g08160?

For comprehensive functional annotation of At1g08160, implement a multi-layered bioinformatic approach:

  • Sequence-Based Analysis:

    • Homology searches (BLAST, HHpred)

    • Conserved domain identification (CDD, Pfam, SMART)

    • Motif searches (PROSITE, ELM)

    • Secondary structure prediction

  • Structural Analysis:

    • Homology-based structure prediction using Swiss-PDB and Phyre2 servers

    • Ab initio modeling for novel structural elements

    • Molecular dynamics simulations to assess structural stability

  • Subcellular Localization Prediction:

    • Plant-specific localization tools (Plant-mPLoc, LOCALIZER)

    • Signal peptide and transit peptide prediction

    • Transmembrane topology prediction

  • Functional Classification:

    • Gene Ontology (GO) term assignment

    • Enzyme Commission (EC) number prediction if applicable

    • Pathway mapping (KEGG, PlantCyc)

  • Prediction Validation:

    • ROC analysis to assess prediction reliability with an expected accuracy of approximately 83%

    • Cross-validation against experimentally characterized homologs

This integrated approach has successfully assigned functions to uncharacterized proteins in other organisms and provides a framework for At1g08160 characterization.

How can transcriptome data be leveraged to understand At1g08160 function?

Transcriptome analysis offers powerful insights into At1g08160 function through:

  • Co-expression Network Analysis:

    • Identify genes with similar expression patterns across conditions

    • Construct modules of co-regulated genes

    • Apply guilt-by-association to infer function based on known genes in the same module

  • Differential Expression Analysis:

    • Compare expression changes under various stresses and developmental stages

    • Identify conditions that specifically regulate At1g08160

  • Expression Quantitative Trait Loci (eQTL) Analysis:

    • Identify genetic variants affecting At1g08160 expression

    • Link expression variation to phenotypic diversity among Arabidopsis accessions

  • Splicing Analysis:

    • Detect alternative splicing events

    • Identify condition-specific isoforms

  • Comparison Across Accessions:

    • Analyze expression variation in different Arabidopsis ecotypes

    • Correlate expression patterns with ecological adaptations

This approach contextualizes At1g08160 within the broader transcriptional landscape, providing functional hypotheses that can be experimentally tested.

What challenges are specific to characterizing plant uncharacterized proteins like At1g08160?

Researchers face several plant-specific challenges when working with uncharacterized proteins:

ChallengeDescriptionMitigation Strategy
Functional RedundancyPlant genomes contain many duplicated genes with redundant functionsGenerate higher-order mutants; use artificial microRNA to target gene families
Conditional PhenotypesFunctions may only manifest under specific conditionsComprehensive phenotyping under diverse stresses and developmental stages
Complex Post-Translational ModificationsPlant-specific modifications affect functionUse plant-based expression systems; analyze PTMs by mass spectrometry
Low Natural Expression LevelsMany regulatory proteins have naturally low abundanceDevelop sensitive detection methods; use epitope tags
Tissue-Specific FunctionsFunction may be restricted to specific cell typesUse tissue-specific promoters; perform single-cell transcriptomics
Structural Variation ImpactTransposable elements and structural variants affect function Sequence multiple accessions; analyze variant impact on expression
Membrane Association DifficultiesMembrane proteins are challenging to purify in active formOptimize detergent conditions; use membrane mimetics

Addressing these challenges requires integrative approaches combining computational prediction, diverse experimental techniques, and careful experimental design.

How might At1g08160 be involved in plant responses to biotic stress?

While specific information about At1g08160's role in biotic stress is not provided in the search results, a methodical approach to investigate this question would include:

  • Expression Analysis Under Pathogen Challenge:

    • Monitor expression changes in response to different pathogens

    • Compare with expression patterns of known defense genes

    • Use methods similar to those in the Arabidopsis-TuMV study

  • Mutant Phenotyping Under Infection:

    • Challenge At1g08160 knockout/overexpression lines with pathogens

    • Measure disease parameters similar to those used in the TuMV study:

      • Symptom severity scored on standardized scales

      • Infection rate across populations

      • Pathogen accumulation quantified by qPCR

      • Temporal progression of disease over 21 days

  • Defense Signaling Analysis:

    • Examine interactions with defense signaling components

    • Measure defense hormone levels (salicylic acid, jasmonic acid)

    • Analyze expression of defense marker genes

  • Potential Structural Variation Effects:

    • Examine whether structural variants in At1g08160 (similar to the Copia-element identified in AT2G14080 ) correlate with disease resistance phenotypes

    • Use long-read sequencing to accurately capture structural variation

This systematic approach would determine whether At1g08160 plays a role in plant immunity and characterize the nature of that involvement.

What approaches are recommended to study potential structural variants of At1g08160 across Arabidopsis accessions?

The study of At1g08160 structural variants requires sophisticated genomic approaches:

  • Structural Variant Detection:

    • Use long-read sequencing (PacBio, Oxford Nanopore) to overcome the limitations of short-read technologies in detecting complex variants

    • Apply specialized SV detection algorithms

    • Target sequencing of the At1g08160 locus in diverse accessions

  • Variant Classification and Annotation:

    • Categorize variants (insertions, deletions, inversions, translocations)

    • Identify mobile element insertions similar to the Copia-element found in AT2G14080

    • Assess potential impacts on gene structure and expression

  • Association Analysis:

    • Perform genome-wide association studies (GWAS) linking variants to phenotypes

    • Develop nested association mapping populations if necessary

    • Account for population structure and linkage disequilibrium

  • Functional Validation:

    • Generate isogenic lines differing only in the SV of interest using CRISPR

    • Quantify allele-specific expression

    • Assess effects on splicing patterns and protein function

  • Evolutionary Analysis:

    • Determine the age and distribution of variants across populations

    • Analyze selection signatures

    • Study correlation with ecological factors

This comprehensive approach would reveal whether At1g08160 structural variants contribute to functional diversity and adaptation in Arabidopsis.

How can systems biology approaches integrate At1g08160 into functional networks?

Systems biology offers powerful tools to contextualize At1g08160 within the broader cellular network:

  • Multi-Omics Data Integration:

    • Combine transcriptomics, proteomics, metabolomics, and phenomics data

    • Apply network inference algorithms to predict functional associations

    • Identify conditions where At1g08160 shows coordinated changes with known pathways

  • Protein-Protein Interaction Network Analysis:

    • Position At1g08160 within the Arabidopsis interactome

    • Identify functional modules containing the protein

    • Apply network statistics to assess centrality and importance

  • Comparative Systems Analysis:

    • Compare network positions of At1g08160 orthologs across plant species

    • Identify conserved network modules suggesting fundamental functions

    • Detect species-specific network rewiring events

  • Metabolic Context Analysis:

    • Incorporate At1g08160 into genome-scale metabolic models

    • Perform flux balance analysis with and without the protein

    • Predict metabolic consequences of gene deletion

  • Machine Learning Integration:

    • Develop predictive models incorporating diverse data types

    • Apply network-based machine learning approaches

    • Use transfer learning from better-characterized plant systems

This integrative approach views At1g08160 not in isolation but as part of complex cellular systems, providing crucial context for understanding its functional role in Arabidopsis thaliana.

What data management strategies are recommended for At1g08160 research?

Effective data management is critical for reproducible research on uncharacterized proteins:

Data TypeManagement ApproachBest Practices
Sequence DataDeposit in public repositories (GenBank, UniProt)Include clear annotation of structural variants
Expression DataSubmit to GEO or ArrayExpressDocument experimental conditions comprehensively
Proteomics DataDeposit in ProteomeXchangeInclude all parameters for identification and quantification
Phenotypic DataUse standardized ontologiesImplement electronic lab notebooks with structured formats
Interaction DataSubmit to BioGRID or IntActDocument detection methods and confidence scores
Structural DataDeposit models in PDB or similarInclude quality assessment metrics

Additionally, researchers should:

  • Implement FAIR principles (Findable, Accessible, Interoperable, Reusable)

  • Use version control for analysis scripts

  • Create containerized workflows for computational analyses

  • Provide detailed methods sections addressing potential sources of variability

How can contradictory experimental results about At1g08160 function be reconciled?

When faced with conflicting data about protein function, implement this systematic reconciliation approach:

  • Methodological Analysis:

    • Compare experimental conditions in detail (temperature, light, media composition)

    • Assess genetic background differences (accession, presence of modifiers)

    • Evaluate technical approach variations (expression systems, tags, purification methods)

  • Replication Strategy:

    • Perform side-by-side comparisons under identical conditions

    • Engage independent laboratories for validation

    • Use multiple complementary techniques to assess the same function

  • Conditional Function Framework:

    • Test whether contradictory results are due to condition-specific functions

    • Systematically vary experimental parameters to identify critical factors

    • Consider developmental timing and tissue-specificity

  • Genetic Background Effects:

    • Assess function in multiple Arabidopsis accessions

    • Create recombinant inbred lines to map modifiers

    • Consider the impact of structural variants like those observed for other Arabidopsis genes

  • Data Integration Approach:

    • Apply Bayesian methods to weigh evidence from multiple sources

    • Develop testable models that accommodate seemingly contradictory observations

    • Consider partial, redundant, or context-dependent functions

This structured approach transforms contradictory results from obstacles into opportunities for deeper mechanistic understanding.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.