Recombinant Arabidopsis thaliana Uncharacterized protein At2g39920 (At2g39920)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if different. We will accommodate requests whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

The specific tag will be determined during production. If you require a particular tag, please specify this in your order; we will prioritize fulfilling such requests.
Synonyms
At2g39920; T28M21.8; Uncharacterized protein At2g39920
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At2g39920
Target Protein Sequence
MSAYTHPMERELSGLSSRGNSELGSRYSIESGCYMTSLAASIFIASLVTFGVLMITLLIA LSTMLQSCENRNIAIVEAQRLDESFGYCKILSLHSQLNSLDEESELPLLCRDVALHRIKQ GIYLRELNFTIQMALTYFQTIKPMNDNCDVVVIDIDDTNLLEQDSYYMKYIEEAKHQKSI LILALYSKLRSQGYSMVLLSRRPETERNATIEQLKSRGYSDWSHLIMSREDTRQKEELER GHRVIGVIGNHMDVLRGQWNWQSKRLFKLPSLTYDDVLDYNER
Uniprot No.

Target Background

Database Links

KEGG: ath:AT2G39920

STRING: 3702.AT2G39920.1

UniGene: At.37118

Protein Families
APS1/VSP family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is At2g39920 and why is it significant for plant research?

At2g39920 is an uncharacterized protein in Arabidopsis thaliana with a full length of 283 amino acids . Despite being classified as "uncharacterized," this protein represents an important research target for understanding plant protein functions and pathways. The significance of studying At2g39920 lies in expanding our knowledge of the Arabidopsis proteome, which serves as a model system for plant molecular biology. Uncharacterized proteins often reveal novel biological mechanisms when thoroughly investigated, potentially uncovering new aspects of plant development, stress responses, or metabolic regulation.

What structural features characterize the At2g39920 protein?

The At2g39920 protein consists of 283 amino acids in its full-length form . While detailed structural information is limited in current literature, recombinant forms of this protein have been produced with His-tags to facilitate purification and characterization studies . Structural prediction algorithms can be employed to generate hypothetical models of protein folding patterns, domains, and potential active sites. For thorough structural characterization, researchers would typically need to employ techniques such as X-ray crystallography, nuclear magnetic resonance (NMR) spectroscopy, or cryo-electron microscopy to determine the three-dimensional structure, which remains to be established for At2g39920.

Are there homologs of At2g39920 identified in other plant species?

Yes, homologs of At2g39920 have been identified in other plant species, notably in Nicotiana tabacum (common tobacco), where it is designated as LOC107775523 . This tobacco homolog is classified as "uncharacterized protein At2g39920-like" and is a protein-coding gene with the sequence information available in databases . The presence of homologs across different plant species suggests evolutionary conservation, which often indicates functional importance. Comparative genomic analysis between Arabidopsis At2g39920 and its homologs could provide valuable insights into potential functions and evolutionary history of this protein family.

What expression systems are optimal for recombinant At2g39920 production?

The optimal expression system documented for At2g39920 is Escherichia coli, which has been successfully used to produce the full-length protein (1-283 amino acids) with a His-tag . When selecting an expression system for At2g39920, researchers should consider:

  • Protein solubility and folding requirements

  • Post-translational modification needs

  • Scale of production required

  • Downstream applications

While E. coli remains the predominant system due to its simplicity and cost-effectiveness, alternative expression systems may include:

  • Yeast systems (Saccharomyces cerevisiae or Pichia pastoris) for improved protein folding

  • Insect cell systems for complex eukaryotic proteins

  • Plant-based expression systems for proteins requiring plant-specific modifications

The choice should be guided by experimental objectives and the specific characteristics of At2g39920 being investigated.

What purification strategies are most effective for His-tagged At2g39920?

For His-tagged At2g39920 , the most effective purification strategy typically involves immobilized metal affinity chromatography (IMAC). The methodological approach includes:

  • Cell lysis under native or denaturing conditions depending on protein solubility

  • Initial capture using Ni-NTA or Co2+ charged resins

  • Washing with buffers containing low concentrations of imidazole to reduce non-specific binding

  • Elution with higher concentrations of imidazole or pH gradient

For enhanced purity, additional purification steps may include:

  • Size exclusion chromatography to separate monomeric protein from aggregates

  • Ion exchange chromatography based on the protein's isoelectric point

  • Affinity tag removal using specific proteases if the tag interferes with functional studies

Optimization of buffer conditions is critical for maintaining protein stability throughout the purification process, especially for uncharacterized proteins where optimal conditions are not established.

What experimental strategies are recommended for characterizing the function of an uncharacterized protein like At2g39920?

Characterizing an uncharacterized protein like At2g39920 requires a multi-faceted approach:

  • Gene Expression Analysis: Utilize microarray or RNA-seq technologies similar to those employed in cytokinin-responsive gene studies . These methods can identify conditions under which At2g39920 is differentially expressed, providing clues to its function.

  • Protein Interaction Studies: Implement yeast two-hybrid screens, co-immunoprecipitation, or pull-down assays to identify interacting partners . The identification of known proteins that interact with At2g39920 can suggest functional pathways.

  • Subcellular Localization: Express fluorescently tagged At2g39920 to determine its location within plant cells, providing insights into potential functional compartments.

  • Reverse Genetics: Generate knockout or knockdown lines using T-DNA insertion mutants or CRISPR-Cas9 technology to observe phenotypic changes that might reveal function.

  • Computational Prediction: Employ bioinformatics tools for sequence analysis, domain prediction, and phylogenetic comparisons with functionally characterized proteins.

By integrating these approaches, researchers can develop and test hypotheses about At2g39920 function in a systematic manner.

How can transcriptomic approaches be utilized to understand At2g39920 function?

Transcriptomic approaches provide powerful insights into At2g39920 function through expression pattern analysis. The methodological framework includes:

  • Microarray Analysis: Similar to the approaches used in cytokinin-responsive gene identification , researchers can analyze At2g39920 expression across multiple experimental conditions. The meta-analysis approach described by researchers who identified 226 differentially regulated genes could be applied to At2g39920 .

  • RNA-Seq Analysis: This technique offers advantages over microarrays, including detection of novel transcripts and higher sensitivity. RNA-seq validated approximately 73% of up-regulated genes identified by microarray meta-analysis in previous studies .

  • Co-expression Network Analysis: By identifying genes with expression patterns similar to At2g39920, researchers can infer functional relationships based on the guilt-by-association principle.

  • Promoter Analysis: In silico examination of the At2g39920 promoter region could reveal transcription factor binding sites, similar to the overrepresentation of type-B Arabidopsis response regulator binding elements found in cytokinin-responsive genes .

  • Time-course Experiments: Analyzing expression changes at multiple time points after specific treatments, similar to the tunicamycin and DTT treatments used in unfolded protein response studies .

The integration of these transcriptomic approaches with different experimental conditions (tissue types, developmental stages, stress treatments) can provide comprehensive insights into the regulatory networks involving At2g39920.

How might At2g39920 potentially be involved in plant stress responses?

While specific evidence for At2g39920's involvement in stress responses is limited, methodological approaches to investigate this possibility include:

  • Expression Analysis Under Stress Conditions: Examine At2g39920 expression changes in response to various stressors (drought, salinity, pathogen infection, temperature extremes) using qRT-PCR or RNA-seq.

  • Comparison with Known Stress Response Pathways: Analyze expression patterns alongside established stress-responsive genes. The unfolded protein response (UPR) research methodology provides a template, where tunicamycin and DTT were used as ER stress-inducing agents to identify responsive genes .

  • Protein Localization During Stress: Monitor changes in subcellular localization of fluorescently-tagged At2g39920 under stress conditions.

  • Functional Testing in Stress-responsive Mutants: Introduce At2g39920 overexpression or knockout constructs into stress-sensitive Arabidopsis mutants to observe phenotypic complementation or enhancement.

  • Post-translational Modification Analysis: Examine stress-induced modifications to At2g39920 using mass spectrometry, as many stress response proteins undergo regulatory modifications.

These methodological approaches would help determine if At2g39920 participates in specific stress response pathways, potentially expanding our understanding of plant adaptation mechanisms.

What approaches can determine if At2g39920 functions in cellular signaling pathways?

Investigating At2g39920's potential role in cellular signaling requires multiple experimental strategies:

  • Phosphorylation State Analysis: Determine if At2g39920 undergoes phosphorylation in response to specific signals using phospho-proteomics approaches.

  • Protein-Protein Interaction Networks: Identify interaction partners through techniques like split-ubiquitin systems, bimolecular fluorescence complementation (BiFC), or proximity-dependent biotin identification (BioID).

  • Genetic Interaction Analysis: Create double mutants with known signaling pathway components to observe synergistic or antagonistic effects.

  • Calcium Signaling Connection: Investigate potential connections to calcium-dependent pathways, considering that calmodulins drive defense and touch responses in plants .

  • Pharmacological Studies: Utilize specific inhibitors or activators of signaling pathways to observe effects on At2g39920 expression, localization, or post-translational modifications.

  • Reporter Gene Assays: Develop reporter constructs to monitor At2g39920 promoter activity in response to various signaling molecules or pathway activators.

These methodologies provide a systematic approach to uncovering potential roles of At2g39920 in plant signaling networks, particularly important given its uncharacterized status.

How can evolutionary analysis of At2g39920 homologs inform functional studies?

Evolutionary analysis of At2g39920 and its homologs, such as the tobacco ortholog LOC107775523 , can provide significant insights through:

  • Sequence Conservation Analysis: Multiple sequence alignment of At2g39920 homologs across species can identify highly conserved regions likely critical for function. Tools like MUSCLE or CLUSTAL should be employed, followed by conservation scoring.

  • Phylogenetic Reconstruction: Building phylogenetic trees using maximum likelihood or Bayesian approaches can reveal evolutionary relationships and potential functional divergence events.

  • Synteny Analysis: Examining the genomic context of At2g39920 and its homologs can identify conserved gene neighborhoods, suggesting functional relationships.

  • Selection Pressure Analysis: Calculating Ka/Ks ratios across homologs can identify regions under purifying or positive selection, indicating functional constraints or adaptive evolution.

  • Domain Architecture Comparison: Identifying shared protein domains across homologs can suggest conserved biochemical functions.

  • Comparative Expression Analysis: Comparing expression patterns of At2g39920 and its homologs across species can reveal conserved regulatory mechanisms.

This evolutionary perspective provides crucial context for functional hypotheses and can guide experimental design by highlighting the most conserved, functionally significant regions of the protein.

What computational approaches can predict potential functions of At2g39920?

Several computational approaches can generate testable hypotheses about At2g39920 function:

  • Protein Structure Prediction: Using tools like AlphaFold or I-TASSER to generate 3D structural models, followed by comparison with structurally characterized proteins.

  • Domain and Motif Identification: Scanning the sequence for known functional domains and motifs using databases like Pfam, PROSITE, or InterPro.

  • Gene Ontology Term Prediction: Employing tools that assign potential GO terms based on sequence similarities and predicted structural features.

  • Molecular Docking Simulations: Predicting potential ligand binding sites and interactions to suggest biochemical functions.

  • Network-based Function Prediction: Using protein-protein interaction networks and gene co-expression networks to infer functions based on the "guilt by association" principle.

  • Text Mining Approaches: Analyzing scientific literature to identify potential connections between At2g39920 sequence features and documented protein functions.

These computational predictions should always be validated through experimental approaches, but they provide valuable direction for laboratory investigations, especially for uncharacterized proteins.

What controls are essential when designing experiments to study At2g39920 expression?

When designing experiments to study At2g39920 expression, several critical controls must be included:

  • Housekeeping Gene Controls: Include reference genes with stable expression (e.g., ACT2, UBQ10, EF1α) for normalization in qRT-PCR studies. Multiple reference genes should be validated for stability under experimental conditions.

  • Tissue-specific Controls: Include tissue-specific marker genes when comparing At2g39920 expression across different plant tissues, as demonstrated in cytokinin-responsive gene studies using shoots, roots, and seedlings .

  • Treatment Controls: Implement proper solvent controls (e.g., DMSO controls when using tunicamycin) and mock treatments that precisely mirror experimental conditions.

  • Time-course Controls: Include time-matched untreated samples for each time point in kinetic studies, as exemplified in the UPR studies with 2h and 5h time points .

  • Biological and Technical Replicates: Ensure sufficient biological replicates (typically n=3) and technical replicates to account for variability, following the approach used in microarray experiments .

  • Positive and Negative Controls: Include genes known to respond to the treatment of interest (positive controls) and genes known not to respond (negative controls).

  • RNA/DNA Quality Controls: Implement rigorous quality control for nucleic acid preparations, including gel electrophoresis to evaluate equal loading and integrity .

These controls ensure the reliability and reproducibility of expression data, critical for accurately characterizing an uncharacterized protein like At2g39920.

What strategies can overcome challenges in expressing recombinant At2g39920?

Researchers may encounter several challenges when expressing recombinant At2g39920. Here are methodological solutions to common issues:

  • Protein Insolubility:

    • Modify expression conditions (temperature, IPTG concentration, induction time)

    • Use solubility-enhancing fusion tags (SUMO, MBP, GST) in addition to the His-tag

    • Screen multiple E. coli strains specialized for difficult proteins (Rosetta, Arctic Express, SHuffle)

    • Employ cell-free expression systems for highly toxic or insoluble proteins

  • Low Expression Yields:

    • Optimize codon usage for E. coli expression

    • Test different promoter systems

    • Co-express molecular chaperones to aid folding

    • Consider autoinduction media instead of IPTG induction

  • Protein Degradation:

    • Add protease inhibitors during all purification steps

    • Reduce purification temperature to 4°C

    • Consider using protease-deficient host strains

    • Optimize buffer conditions to enhance stability

  • Purification Difficulties:

    • Adjust imidazole concentrations in binding and washing buffers

    • Test different metal ions for IMAC (Ni2+, Co2+, Cu2+)

    • Consider native versus denaturing conditions

    • Implement on-column refolding for insoluble proteins

These methodological interventions, applied systematically, can significantly improve the success rate of recombinant At2g39920 expression and purification.

How can researchers address data inconsistencies when studying At2g39920?

When confronting data inconsistencies in At2g39920 research, a systematic troubleshooting approach includes:

  • Experimental Variation Assessment:

    • Calculate Pearson correlation factors between replicates, similar to the approach used in microarray meta-analysis

    • Employ statistical methods appropriate for the data type to identify outliers

    • Consider increased biological replication to account for natural variation

  • Technical Validation:

    • Validate key findings using independent methods (e.g., microarray results with qRT-PCR or NanoString)

    • Implement multiple controls as described in section 6.1

    • Consider the impact of experimental conditions on results (e.g., continuous vs. intermittent treatment)

  • Data Integration Challenges:

    • Apply filtering criteria empirically defined for your specific experimental system

    • Use multiple analytical approaches and look for convergent results

    • Consider the effect of experimental design variables (treatment regime, growth conditions, developmental stages)

  • Conflicting Results Resolution:

    • Systematically examine differences in experimental conditions

    • Consider tissue-specific or developmental stage-specific effects

    • Evaluate whether method of application (e.g., spraying versus immersion) affects results

By applying these methodological approaches to address inconsistencies, researchers can develop a more robust understanding of At2g39920 function despite the challenges inherent in studying uncharacterized proteins.

What emerging technologies could accelerate functional characterization of At2g39920?

Several cutting-edge technologies hold promise for advancing At2g39920 functional characterization:

  • CRISPR-based Technologies:

    • Base editing for introducing specific mutations without double-strand breaks

    • CRISPRi/CRISPRa for reversible gene repression or activation

    • Prime editing for precise nucleotide replacements to study specific amino acid functions

  • Single-cell Omics:

    • Single-cell RNA-seq to reveal cell-type specific expression patterns

    • Single-cell proteomics to identify protein abundance at cellular resolution

    • Spatial transcriptomics to map expression within complex tissues

  • Advanced Imaging Techniques:

    • Super-resolution microscopy for precise subcellular localization

    • FRET-FLIM for in vivo protein interaction validation

    • Light-sheet microscopy for dynamic tracking in live tissues

  • Integrative Multi-omics:

    • Combined analysis of transcriptome, proteome, metabolome, and interactome data

    • Network biology approaches to position At2g39920 within cellular systems

    • Machine learning algorithms to predict function from multi-dimensional datasets

  • Protein Structure Determination:

    • Cryo-EM for membrane protein structures

    • AlphaFold2 and related AI approaches for accurate structure prediction

    • Hydrogen-deuterium exchange mass spectrometry for dynamic structural information

These technologies, applied systematically to At2g39920, could significantly accelerate understanding of this uncharacterized protein's function in plant biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.