Recombinant Arabidopsis thaliana Uncharacterized protein At3g58460 (At3g58460)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All protein shipments are standardly accompanied by normal blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a designated tag type in mind, please inform us and we will prioritize developing it for your protein.
Synonyms
RBL15; RBL11; At3g58460; F14P22.50; Rhomboid-like protein 15; AtRBL15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-403
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
RBL15
Target Protein Sequence
MRPNIVTEAGVQTRVGQWWNAIPFLTSSVVVVCGVIYLICLLTGYDTFYEVCFLPSAIIS RFQVYRFYTAIIFHGSLLHVLFNMMALVPMGSELERIMGSVRLLYLTVLLATTNAVLHLL IASLAGYNPFYQYDHLMNECAIGFSGILFSMIVIETSLSGVTSRSVFGLFNVPAKLYPWI LLIVFQLLMTNVSLLGHLCGILSGFSYSYGLFNFLMPGSSFFTTIESASWMSSFIRRPKF IMCTGGNPSSYIPTYSAQNTTSSGFSTGNAWRSLSSWLPQREASNQSSEDSRFPGRGRTL STARDPTAPAGETDPNLHARLLEDSSSPDRLSDATVNTVADSRQAPIANAAVLPQSQGRV AASEEQIQKLVAMGFDRTQVEVALAAADDDLTVAVEILMSQQA
Uniprot No.

Target Background

Function
This protein is a probable rhomboid-type serine protease that catalyzes intramembrane proteolysis. It may play a role in senescence.
Database Links

KEGG: ath:AT3G58460

STRING: 3702.AT3G58460.2

UniGene: At.43287

Protein Families
Peptidase S54 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are the primary approaches to characterize an uncharacterized protein like At3g58460?

Characterization of uncharacterized proteins requires an integrated approach combining multiple bioinformatic tools and experimental methods. For proteins like At3g58460, researchers should follow a systematic workflow:

  • Physicochemical characterization: Use ExPASy's ProtParam tool to determine basic properties including theoretical isoelectric point (pI), molecular weight, instability index, and grand average of hydropathicity (GRAVY). The instability index predicts protein stability (values <40 indicate stability, while values >40 suggest instability). GRAVY values indicate polarity, with negative values suggesting non-polar proteins and positive values indicating polar proteins .

  • Sequence homology analysis: Perform comparative analysis with related organisms to identify conserved regions that may indicate functional domains.

  • Subcellular localization prediction: Employ tools like PSORTb 3.0 to determine the likely cellular location based on amino acid sequence features, which provides crucial insights into potential function .

  • Secretory nature assessment: Apply SignalP 5.0 to identify potential signal peptides and cleavage sites, which can distinguish between different signal peptide types (Sec/SPI, Sec/SPII, and Tat/SPI) based on transport and cleavage mechanisms .

This multi-faceted approach provides foundational data necessary for subsequent functional characterization and hypothesis generation.

How can I access T-DNA insertion mutants for studying At3g58460?

T-DNA insertion mutants are valuable tools for functional characterization of uncharacterized proteins through reverse genetics. To access these resources for At3g58460:

  • Identify available T-DNA lines: Use the T-DNA Express database (http://signal.salk.edu/cgi-bin/tdnaexpress) to search for insertion lines in At3g58460. Enter the AGI gene identifier (At3g58460) in the search box to visualize all available insertions in this gene .

  • Evaluate insertion positions: Determine the location of T-DNA insertions relative to exons, introns, and regulatory regions. Insertions in exons typically cause complete loss-of-function, while intronic or promoter insertions may result in partial function disruption .

  • Order seed stocks: Request identified T-DNA lines from public repositories such as the Arabidopsis Biological Resource Center (ABRC: https://abrc.osu.edu/) or The European Arabidopsis Stock Centre (NASC: http://arabidopsis.info/)[1].

  • Confirm insertions: Upon receiving seeds, verify the presence and homozygosity of insertions using PCR with gene-specific primers and T-DNA border primers, following standard genotyping protocols.

This approach leverages extensive mutant resources in Arabidopsis, facilitating functional characterization through phenotypic analysis.

What in silico approaches can predict the function of At3g58460?

For uncharacterized proteins like At3g58460, comprehensive in silico functional prediction involves multiple computational approaches:

  • Domain analysis: Identify conserved domains using databases like Pfam, SMART, and CDD to infer potential functional modules.

  • Structural prediction: Generate 3D models using tools like iTASSER followed by active site identification with CastP server to identify potential binding pockets and functional residues, as demonstrated for other uncharacterized proteins .

  • Protein-protein interaction prediction: Use STRING, INTERPRETS, or similar tools to predict potential interaction partners based on co-expression, genomic context, and other evidence types.

  • Phylogenetic analysis: Construct evolutionary trees with homologs from other species to identify orthologous relationships and potential functional conservation.

  • Gene ontology prediction: Apply tools like Blast2GO to assign potential molecular functions, biological processes, and cellular components based on sequence similarity and other features.

This multi-tool approach provides layered evidence for functional hypotheses that can guide subsequent experimental validation.

How can microarray or RNA-Seq data be leveraged to understand At3g58460 function?

Expression profiling provides valuable insights into potential functions of uncharacterized proteins by associating them with specific biological processes or stress responses:

  • Co-expression analysis: Identify genes with similar expression patterns as At3g58460 across various conditions, as co-expressed genes often participate in related biological processes. For instance, if At3g58460 shows expression patterns similar to known defense-related genes, it may function in plant immunity .

  • Differential expression analysis: Examine expression changes of At3g58460 under various treatments (e.g., pathogen infection, hormone treatments). As demonstrated in previous Arabidopsis studies, transcriptional responses to treatments like salicylic acid, methyl jasmonate, or ethylene can reveal involvement in specific defense pathways .

  • Expression data integration: Create a data table summarizing fold-changes in At3g58460 expression across multiple conditions, similar to this example format based on microarray approaches:

TreatmentFold Changep-valuePotential Pathway Connection
Pathogen infection±X.XX0.0XXDefense response
Salicylic acid±X.XX0.0XXSAR pathway
Methyl jasmonate±X.XX0.0XXJA signaling
Ethylene±X.XX0.0XXEthylene response
Abiotic stress±X.XX0.0XXStress tolerance
  • Temporal analysis: Examine expression dynamics across developmental stages or time points after treatment to identify transient versus sustained responses .

This approach has successfully identified functions for numerous previously uncharacterized genes in Arabidopsis and may provide important clues about At3g58460.

What transformation methods are most effective for expressing recombinant At3g58460 in Arabidopsis?

For successful transformation and expression of recombinant At3g58460 in Arabidopsis, the floral dip method provides the most efficient approach:

  • Vector construction: Clone the At3g58460 coding sequence into an appropriate plant expression vector with a strong promoter (e.g., 35S) and appropriate tags for detection (e.g., GFP, FLAG, or His-tag).

  • Agrobacterium preparation: Transform the construct into an appropriate Agrobacterium strain such as GV3101, LBA4404, or EHA105 .

  • Floral dip transformation: Apply the simplified floral dip protocol, which eliminates the need for vacuum infiltration and plant uprooting:

    • Grow Arabidopsis plants until they have multiple flower buds

    • Suspend Agrobacterium cells (OD600 = 0.8-1.0) in a solution containing 5% sucrose and 0.05% Silwet L-77

    • Invert and dip flowering plants into the bacterial suspension for 10-15 seconds

    • Cover plants for 24 hours to maintain humidity

    • Return to normal growth conditions and collect seeds after maturation

  • Selection and confirmation: Select transformants using appropriate antibiotics or herbicides, then confirm transgene presence by PCR and expression by RT-PCR or Western blotting.

This simplified approach yields transformation efficiencies of approximately 0.5-1% without requiring specialized equipment, making it accessible for most research laboratories .

How can subcellular localization of At3g58460 be determined experimentally?

Determining the subcellular localization of At3g58460 is crucial for understanding its function. Employ these complementary approaches:

  • Fluorescent protein fusion: Create N- or C-terminal fusions of At3g58460 with GFP or other fluorescent proteins. Transform these constructs into Arabidopsis using the floral dip method . Visualize the fusion protein in plant cells using confocal microscopy to determine localization patterns.

  • Co-localization studies: Perform co-localization with known subcellular markers (e.g., ER-tracker, MitoTracker) to precisely identify the organelle or compartment where At3g58460 resides.

  • Immunolocalization: Generate antibodies against At3g58460 or use antibodies against fusion tags. Perform immunofluorescence microscopy on fixed plant cells to visualize the native protein location.

  • Cell fractionation: Use differential centrifugation to separate cellular components (nuclei, mitochondria, chloroplasts, etc.). Detect At3g58460 in different fractions using Western blotting to confirm localization biochemically.

The combined results from these approaches provide robust evidence for the protein's subcellular localization, which is vital for generating functional hypotheses. For example, nuclear localization might suggest involvement in transcriptional regulation, while chloroplast localization could indicate a role in photosynthesis-related processes.

How can I phenotypically characterize At3g58460 T-DNA insertion mutants?

Comprehensive phenotypic characterization of At3g58460 T-DNA insertion mutants involves systematic observation across developmental stages and conditions:

  • Confirm homozygosity and gene disruption: Before phenotypic analysis, verify that the T-DNA insertion mutants are homozygous and that gene expression is disrupted using PCR-based genotyping and RT-PCR .

  • Basic growth parameters: Assess fundamental growth metrics including:

    • Germination rate and timing

    • Root architecture (primary root length, lateral root number)

    • Rosette diameter and leaf morphology

    • Flowering time and reproductive development

    • Seed yield and viability

  • Stress response profiling: Challenge mutants with various stressors to identify condition-specific phenotypes:

    • Biotic stress (pathogen infection with fungi like Alternaria brassicicola)

    • Abiotic stress (drought, salt, temperature extremes)

    • Hormone treatments (salicylic acid, jasmonate, ethylene)

  • Cellular and molecular phenotypes: Examine tissue-specific or subcellular abnormalities:

    • Cell morphology and ultrastructure

    • Metabolite profiles

    • Transcriptome alterations using microarray or RNA-seq

  • Comparison with wild-type: Always perform side-by-side phenotypic comparison with the wild-type parental genotype (typically Col-0) under identical conditions .

This systematic approach can reveal subtle phenotypes that may not be apparent under standard growth conditions but emerge under specific stresses or developmental stages.

What strategies can detect potential functional redundancy when At3g58460 mutants show no obvious phenotype?

Functional redundancy is common in Arabidopsis, and several strategies can address this challenge when single mutants show no discernible phenotype:

  • Generate higher-order mutants: Identify close homologs of At3g58460 through phylogenetic analysis and create double, triple, or higher-order mutants through genetic crosses between single T-DNA insertion lines .

  • Conditional expression approaches:

    • Employ inducible RNAi or artificial microRNA constructs targeting multiple gene family members simultaneously

    • Use dominant-negative constructs that may interfere with function of redundant proteins

    • Create CRISPR/Cas9 multiplex constructs targeting several related genes

  • Sensitized background approach: Introduce the At3g58460 mutation into sensitized genetic backgrounds where related pathways are already compromised, potentially revealing phenotypes masked by redundancy.

  • Overexpression analysis: Complement phenotypic studies with overexpression lines, as gain-of-function phenotypes may reveal function even when loss-of-function does not.

  • Environmental perturbation: Test mutants under extreme conditions that may exceed the compensatory capacity of redundant systems:

    • Combined stresses (e.g., simultaneous drought and pathogen infection)

    • Fluctuating rather than static stress conditions

    • Developmental or environmental transitions

These approaches have successfully revealed functions for many genes with redundant family members in Arabidopsis and may uncover At3g58460 function despite initial lack of phenotype.

How can CRISPR/Cas9 genome editing be applied to study At3g58460 function?

CRISPR/Cas9 technology offers several advantages over traditional T-DNA insertion methods for studying At3g58460:

  • Precise modification options:

    • Complete knockout: Design gRNAs targeting exons near the 5' end of At3g58460 to create frameshift mutations

    • Domain-specific mutations: Target specific functional domains identified through in silico analysis to create partial loss-of-function alleles

    • Promoter editing: Modify regulatory regions to alter expression patterns rather than protein function

    • Base editing: Make specific amino acid substitutions using cytosine or adenine base editors to test structure-function hypotheses

  • Multiplex editing: Design multiple gRNAs to target At3g58460 along with its potential redundant homologs simultaneously, addressing functional redundancy more efficiently than through crossing single mutants .

  • Epitope tagging: Insert sequences encoding FLAG, HA, or other affinity tags at the endogenous locus to facilitate protein detection while maintaining native expression patterns.

  • Transformation approach: Use the floral dip method with appropriate modifications for CRISPR/Cas9 vectors :

    • Select an efficient Agrobacterium strain (e.g., GV3101)

    • Transform plants at optimal developmental stage for maximum transformation efficiency

    • Screen transgenic plants using appropriate selection markers

This approach enables more sophisticated functional analysis compared to traditional insertion mutagenesis, particularly for addressing complex questions about protein domains or gene redundancy.

What proteomics approaches can identify interaction partners of At3g58460?

Identifying protein interaction partners provides critical insights into the functional context of uncharacterized proteins like At3g58460:

  • Affinity purification-mass spectrometry (AP-MS):

    • Express tagged versions (FLAG, HA, or His-tag) of At3g58460 in Arabidopsis using the floral dip method

    • Perform affinity purification under native conditions to capture interaction partners

    • Identify co-purifying proteins by mass spectrometry

    • Filter results against appropriate controls to remove non-specific interactions

  • Proximity-dependent biotin labeling (BioID or TurboID):

    • Fuse At3g58460 with a biotin ligase (BioID2 or TurboID)

    • Express the fusion protein in Arabidopsis

    • Proximal proteins become biotinylated and can be purified using streptavidin

    • Identify labeled proteins by mass spectrometry

  • Yeast two-hybrid screening:

    • Use At3g58460 as bait to screen Arabidopsis cDNA libraries

    • Validate positive interactions with targeted assays

    • Create an interaction network visualization:

Interacting ProteinFunctional CategoryDetection MethodConfidence Score
Protein ASignalingAP-MSHigh
Protein BMetabolismY2HMedium
Protein CDefense responseBioIDHigh
  • Co-immunoprecipitation validation: Confirm key interactions by co-immunoprecipitation experiments followed by Western blotting.

These complementary approaches provide a comprehensive view of the protein interaction network surrounding At3g58460, offering crucial insights into its functional role.

How might At3g58460 function in Arabidopsis defense responses?

Investigating At3g58460's potential role in plant defense requires integrating expression data with functional assays:

  • Expression profile analysis: Examine At3g58460 expression changes following pathogen infection or defense-related hormone treatments. Previous microarray studies in Arabidopsis have shown that many uncharacterized proteins are differentially expressed after treatments with salicylic acid, methyl jasmonate, ethylene, or pathogen challenge like Alternaria brassicicola .

  • Pathway assignment: Analyze expression patterns to determine if At3g58460 clusters with known defense genes. Defense pathways in Arabidopsis show significant overlap, with approximately 5% of genes responding to multiple treatments, indicating potential involvement in coordinated responses .

  • Mutant challenge assays: Challenge At3g58460 T-DNA mutants with pathogens to assess altered susceptibility or resistance:

    • Bacterial pathogens (e.g., Pseudomonas syringae)

    • Fungal pathogens (e.g., Alternaria brassicicola)

    • Oomycete pathogens (e.g., Hyaloperonospora arabidopsidis)

  • Defense marker analysis: Measure expression of established defense markers in At3g58460 mutants after pathogen challenge to identify specific affected pathways:

Marker GeneDefense PathwayExpression in WTExpression in at3g58460
PR1Salicylic acidXX-fold ↑XX-fold ↑/↓
PDF1.2Jasmonate/EthyleneXX-fold ↑XX-fold ↑/↓
VSP2JasmonateXX-fold ↑XX-fold ↑/↓

This integrated approach can reveal whether At3g58460 functions in specific defense pathways, potentially identifying novel components of plant immunity.

What strategies can determine if At3g58460 is involved in cross-talk between defense signaling pathways?

Plant defense signaling involves complex cross-talk between pathways, and uncharacterized proteins may function as integration points:

  • Hormone response profiling: Treat At3g58460 mutants with defense hormones individually and in combinations:

    • Salicylic acid (SA)

    • Methyl jasmonate (MJ)

    • Ethylene

    • SA+MJ

    • SA+ethylene

    • MJ+ethylene

  • Transcriptomic analysis: Perform RNA-seq on treated mutants and wild-type plants to identify differentially regulated genes and pathways. Previous microarray studies have identified both synergistic and antagonistic interactions between defense pathways, with some genes coinduced by SA and MJ treatments while others show opposite regulation patterns .

  • Epistasis analysis: Generate double mutants between At3g58460 and known defense signaling components:

    • At3g58460/sid2 (SA biosynthesis)

    • At3g58460/coi1 (JA signaling)

    • At3g58460/ein2 (ethylene signaling)

  • Metabolite quantification: Measure defense-related metabolites in mutants versus wild-type plants after pathogen challenge:

    • Salicylic acid levels

    • Jasmonic acid and derivatives

    • Camalexin and other phytoalexins

    • Reactive oxygen species

These approaches can determine whether At3g58460 functions at points of convergence or divergence between established defense signaling networks, potentially revealing novel aspects of pathway cross-talk.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.