Recombinant Arabidopsis thaliana Uncharacterized protein At4g01150, chloroplastic (At4g01150)

Shipped with Ice Packs
In Stock

Description

Protein Overview

At4g01150, annotated as an uncharacterized chloroplastic protein, is a thylakoid membrane-associated protein in Arabidopsis thaliana. Despite its designation as "uncharacterized," emerging evidence links it to the CURVATURE THYLAKOID1 (CURT1) family, which plays a critical role in thylakoid membrane architecture .

PropertyValueSource
Gene IDAT4G01150
Protein NameUncharacterized protein At4g01150, chloroplastic
Length164 amino acids
Molecular Weight17.7 kDa
LocalizationThylakoid membrane, chloroplast
FunctionInvolved in grana stack curvature and thylakoid membrane structure
Recombinant AvailabilityCommercially available as purified recombinant protein (ELISA grade)

Protein Characteristics

  • Sequence and Domains:

    • Contains a predicted N-terminal chloroplast targeting peptide and two transmembrane domains .

    • Shares structural homology with the CURT1 family, which includes a conserved amphipathic helix and oligomerization motifs .

Role in Thylakoid Morphology

The CURT1 family, including At4g01150 (CURT1A), is essential for:

  • Grana margin formation: Oligomerization of CURT1 proteins induces curvature at thylakoid margins, enabling proper stacking .

  • Regulation of grana size: Overexpression results in taller, slimmer grana stacks, while knockouts lead to flat, lobe-like thylakoids .

Experimental ObservationCURT1 ActivityPhenotypeSource
CURT1A OverexpressionEnhanced thylakoid curvatureIncreased grana layers, reduced diameter
CURT1A Knockout (curt1a)Loss of curvature-inducing functionFlat, unstacked thylakoids

Production Systems

While specific protocols for At4g01150 recombinant production are not detailed in available literature, Arabidopsis-based systems are increasingly used for plant protein expression due to:

  • Homologous post-translational modifications: Enables proper folding and activity .

  • Scalability: Achieves yields of ~0.4 mg/g fresh weight for model proteins like mCherry .

Functional Ambiguity

Despite its association with CURT1A, At4g01150 remains listed as "uncharacterized" in some databases (e.g., SUBA5) , highlighting:

  • Nomenclature conflicts: Dual classification as "uncharacterized" and "CURT1A" reflects evolving functional annotations.

  • Limited biochemical data: No direct transport or enzymatic activity has been reported, contrasting with other CURT1 family members .

Potential Applications

  • Thylakoid engineering: Manipulation of At4g01150/CURT1A could optimize chloroplast ultrastructure for enhanced photosynthesis.

  • Structural studies: Recombinant At4g01150 may enable cryo-EM or X-ray crystallography to resolve its oligomerization and membrane interaction mechanisms .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us; we will prioritize development of the specified tag.
Synonyms
CURT1A; At4g01150; A_IG002N01.18; F2N1.18; Protein CURVATURE THYLAKOID 1A, chloroplastic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
63-164
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CURT1A
Target Protein Sequence
ASSEETSSIDTNELITDLKEKWDGLENKSTVLIYGGGAIVAVWLSSIVVGAINSVPLLPK VMELVGLGYTGWFVYRYLLFKSSRKELAEDIESLKKKIAGSE
Uniprot No.

Target Background

Function
This protein influences thylakoid membrane architecture by inducing membrane curvature.
Database Links

KEGG: ath:AT4G01150

STRING: 3702.AT4G01150.1

UniGene: At.48817

Protein Families
CURT family
Subcellular Location
Plastid, chloroplast, plastoglobule. Membrane; Multi-pass membrane protein. Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the current understanding of At4g01150 (CURT1A) in Arabidopsis thaliana?

At4g01150, previously designated as an uncharacterized protein, has been identified as CURT1A, a member of the CURT1 protein family in Arabidopsis. This protein family consists of chloroplast-localized proteins (categorized as A, B, C, and D) with distinctive structural features including four helices and two transmembrane regions, exhibiting both hydrophilic and hydrophobic sides . CURT1A is integral to thylakoid membrane architecture and organization, playing a crucial role in maintaining proper chloroplast structure and function.

The protein has been found to be significantly up-regulated (1.20-fold, P=0.05) in mutants lacking certain Deg protease complexes compared to wild-type plants, suggesting its involvement in proteolytic pathways or compensatory mechanisms within the chloroplast . It is classified as a membrane-localized protein (designated "M" in localization studies) with specific functions in thylakoid architecture maintenance .

How does CURT1A contribute to chloroplast structure and function?

CURT1A contributes to chloroplast function primarily through its role in thylakoid membrane architecture. The protein is involved in establishing and maintaining the distinct organization of thylakoid membranes, which consist of grana (structures concentrating Photosystem II) and stroma lamellae (containing Photosystem I and ATP synthase) .

What protein-protein interactions have been identified for CURT1A?

Yeast two-hybrid studies have identified several key interaction partners for CURT1A, as summarized in the following table:

Protein name, Accession No.Detection methodSubcellular location prediction
RGS1, At3g26090Yeast two-hybridCP: 5.8; MT: 0.0; SEC: 16.4
RTNLB8, At3g10260Yeast two-hybridCP: 0.0; MT: 0.0; SEC: 0.9
RTNLB4, At5g41600Yeast two-hybridCP: 0.9; MT: 0.0; SEC: 2.2
Putative uncharacterized protein, At3g29270Yeast two-hybridCP: 1.3; MT: 2.8; SEC: 3.8

Note: CP = chloroplast; MT = mitochondria; SEC = secretory pathway

Notably, both CURT1A and LHCB1.5 interact with RGS1, suggesting a potential regulatory network involved in chloroplast development and function . RGS1 typically functions as a GTPase activating protein (GAP) to the α subunit of heterotrimeric G-protein (GPA1) in the plasma membrane, but its interaction with chloroplast proteins indicates potential novel functions or regulatory mechanisms crossing compartmental boundaries .

How can researchers effectively study CURT1A's interaction with vesicle transport mechanisms?

To study CURT1A's involvement in vesicle transport mechanisms, researchers should employ a multi-faceted approach:

  • Fluorescence microscopy with vesicle markers: Utilize fluorescently-tagged vesicle markers alongside labeled CURT1A to track co-localization during chloroplast development and under various stress conditions.

  • Temperature-dependent assays: Since chloroplast vesicle accumulation has been observed at 4°C in certain mutants, conducting temperature shift experiments can help elucidate CURT1A's role in vesicle formation or trafficking .

  • Co-immunoprecipitation with known vesicle transport proteins: Particularly focusing on the identified interactors like RTNLB4 and RTNLB8, which belong to the reticulon family implicated in intracellular transport processes .

  • Comparative studies with mutants: Analyzing vesicle formation and thylakoid architecture in wild-type plants versus curt1a mutants and plants with altered expression of CURT1A interacting partners.

The connection between CURT1A and RTNLBs is particularly interesting since RTNLBs have been associated with ER-chloroplast traffic, suggesting CURT1A may serve as a bridge between different cellular compartments for membrane or protein trafficking .

What phenotypic differences are observed in plants with altered CURT1A expression?

Comparative proteomic analyses between wild-type plants and various mutants have revealed significant changes in chloroplast protein levels when CURT1A function is compromised. In particular, studies have shown that chloroplast vesicle accumulation and altered grana stack formation occur in certain mutants affecting proteins that interact with CURT1A .

The relationship between CURT1A and thylakoid membrane formation is evidenced by observations in mutants where CURT1A levels are changed. These phenotypic changes can include:

  • Altered thylakoid membrane curvature

  • Changes in grana stack density and organization

  • Accumulation of vesicles within the chloroplast

  • Impaired association of light-harvesting complexes with photosystems

When designing experiments to study CURT1A function, researchers should quantitatively assess these phenotypic markers using techniques such as transmission electron microscopy for ultrastructural analysis and biochemical fractionation to examine protein complex assembly.

How does CURT1A expression change in response to protease deficiency?

Proteomic analysis of protease-deficient mutants has revealed that CURT1A is significantly up-regulated in the deg158 mutant compared to wild-type plants, with a fold change of 1.20 (P=0.05) . This suggests that CURT1A may be a substrate for Deg proteases or that its expression is indirectly regulated by proteolytic pathways in the chloroplast.

The table below summarizes the differential regulation of CURT1A and other thylakoid membrane proteins in protease-deficient mutants:

Gene IdentifierNameFunctiondeg1/Wild Type (P Value)deg158/Wild Type (P Value)Location
AT4G01150CURT1AThylakoid architecturenot significant1.20 (0.05)M

Note: M = membrane localization

These findings indicate that researchers studying CURT1A should consider the potential influence of chloroplast proteolytic systems on CURT1A levels and function. Experimental designs should account for these regulatory mechanisms when interpreting results from studies involving CURT1A expression or activity.

What are the recommended methods for isolating and purifying recombinant CURT1A protein?

For successful isolation and purification of recombinant CURT1A, researchers should consider the following methodological approach:

  • Expression system selection: Given CURT1A's membrane-associated nature, expression systems capable of properly handling membrane proteins should be prioritized. Bacterial systems like E. coli with specialized strains (C41, C43) designed for membrane protein expression can be effective.

  • Solubilization optimization: Due to its transmembrane domains, CURT1A requires careful solubilization using mild detergents. A detergent screen including n-dodecyl-β-D-maltopyranoside (DDM), n-octyl-β-D-glucopyranoside (OG), and digitonin should be conducted to determine optimal solubilization conditions.

  • Affinity purification: Incorporating affinity tags (His, Strep, or GST) at positions that don't interfere with protein folding or function allows for efficient purification using affinity chromatography.

  • Quality control assessments: Following purification, circular dichroism spectroscopy should be employed to confirm proper protein folding, particularly the predicted four-helix structure.

  • Functional validation: In vitro membrane binding or curvature assays using artificial liposomes can help verify that the purified protein retains its native activity.

This comprehensive approach ensures the isolation of properly folded, functional CURT1A protein for subsequent structural and biochemical studies.

What advanced imaging techniques are most effective for studying CURT1A localization and dynamics in chloroplasts?

Multiple advanced imaging approaches can be utilized to study CURT1A localization and dynamics:

  • Super-resolution microscopy: Techniques like Structured Illumination Microscopy (SIM), Stimulated Emission Depletion (STED) microscopy, or Photoactivated Localization Microscopy (PALM) enable visualization of CURT1A distribution within thylakoid membranes at resolutions below the diffraction limit, revealing precise localization patterns.

  • Fluorescence Recovery After Photobleaching (FRAP): This approach can measure CURT1A mobility within thylakoid membranes, providing insights into its dynamic behavior during thylakoid development or in response to environmental stresses.

  • Correlative Light and Electron Microscopy (CLEM): Combining fluorescence microscopy with transmission electron microscopy allows researchers to correlate CURT1A localization with specific ultrastructural features of thylakoid membranes.

  • Live-cell imaging with environment control: Using controlled chambers to modulate light intensity, temperature, or other environmental factors while imaging living plant cells allows for real-time observation of CURT1A dynamics under varying conditions.

  • Multi-color imaging: Simultaneous visualization of CURT1A with other chloroplast proteins (particularly its interaction partners) provides contextual information about its function within protein complexes.

When implementing these techniques, researchers should use fluorescent protein fusions or antibody labeling that minimally disrupts CURT1A's native behavior and ensure proper controls to distinguish specific localization from background signal.

How does CURT1A contribute to thylakoid membrane biogenesis and maintenance?

CURT1A plays a crucial role in thylakoid membrane biogenesis through its influence on membrane curvature and organization. Research indicates that CURT1A is particularly concentrated at the curved margins of grana stacks, where it helps establish and maintain the characteristic architecture of thylakoid membranes .

The protein's contribution to thylakoid biogenesis appears to involve multiple mechanisms:

  • Direct induction of membrane curvature through its structural properties

  • Interaction with other proteins involved in thylakoid formation

  • Potential role in vesicle-mediated transport processes during thylakoid development

Evidence supporting CURT1A's involvement in vesicle transport comes from its interaction with proteins like RTNLB4 and RTNLB8, which are associated with membrane trafficking . Additionally, the interaction with RGS1, which in turn interacts with GPA1 (a protein that also interacts with THF1, required for normal vesicle formation during thylakoid biogenesis), suggests CURT1A may be part of a regulatory network controlling vesicle-mediated processes in chloroplast development .

What is the relationship between CURT1A and light-harvesting complex proteins?

Evidence suggests a functional relationship between CURT1A and light-harvesting complex proteins, particularly LHCB1.5. Both CURT1A and LHCB1.5 interact with RGS1, indicating a potential regulatory connection . This relationship may be part of an alternative thylakoid targeting pathway for LHC proteins using vesicles, complementing the well-established Signal Recognition Particle (SRP) pathway .

Researchers investigating this relationship should consider:

  • The spatial distribution of CURT1A relative to LHC proteins in thylakoid membranes using immunogold electron microscopy or super-resolution fluorescence microscopy

  • The effect of CURT1A mutations or altered expression on LHC protein incorporation into thylakoid membranes

  • Protein transport assays using isolated chloroplasts to determine if CURT1A influences the rate or efficiency of LHC protein integration into thylakoid membranes

  • Co-immunoprecipitation studies to identify additional components that might function with CURT1A and LHC proteins in a complex

Understanding this relationship could provide important insights into the mechanisms of photosystem assembly and thylakoid membrane organization during chloroplast development.

How can researchers integrate multi-omics data to better understand CURT1A function?

A comprehensive understanding of CURT1A function requires integration of multiple omics datasets through the following methodological approach:

  • Data harmonization: Before integration, researchers must normalize data across different platforms and experiments to ensure comparability. This involves standardization procedures appropriate to each data type (e.g., log transformation, quantile normalization).

  • Network analysis: Construct protein-protein interaction networks centered on CURT1A using proteomics data, then overlay transcriptomic data to identify co-regulated genes and metabolomic data to associate functional pathways.

  • Pathway enrichment analysis: Identify biological processes and molecular functions enriched in datasets where CURT1A shows significant changes, using tools like Gene Ontology (GO) or Kyoto Encyclopedia of Genes and Genomes (KEGG).

  • Machine learning approaches: Implement supervised learning algorithms (Random Forest, Support Vector Machines) to identify patterns and predict functional relationships from integrated datasets.

  • Visualization strategies: Utilize Sankey diagrams, heatmaps with hierarchical clustering, or force-directed network graphs to represent complex relationships across multiple data types.

For effective implementation, researchers should utilize dedicated multi-omics integration platforms or custom pipelines in R or Python that can handle diverse data structures while accounting for their unique statistical properties.

What are the structural determinants of CURT1A's membrane-curving properties?

Understanding the structural basis of CURT1A's membrane-curving function represents an important frontier in research. The protein contains four helices and two transmembrane regions with distinct hydrophilic and hydrophobic sides , suggesting a potential mechanism for inducing membrane curvature similar to other membrane-shaping proteins.

To investigate this question, researchers should consider:

  • Structural biology approaches: X-ray crystallography or cryo-electron microscopy of purified CURT1A, focusing on the arrangement of transmembrane helices and their interaction with lipid bilayers.

  • Mutagenesis studies: Systematic alteration of key residues in the transmembrane domains or at the membrane-cytosol interface to identify regions critical for curvature induction.

  • In vitro membrane deformation assays: Using artificial liposomes with compositions mimicking thylakoid membranes to directly observe CURT1A-induced curvature under controlled conditions.

  • Molecular dynamics simulations: Computational modeling of CURT1A-membrane interactions to predict structural determinants of curvature induction at the molecular level.

These approaches would clarify whether CURT1A functions through scaffolding mechanisms (imposing curvature through its intrinsic shape) or through hydrophobic insertion (creating membrane asymmetry by partial embedding of amphipathic regions).

How does CURT1A function vary across different plant species and under varying environmental conditions?

Comparative analysis of CURT1A across plant species and environmental conditions represents an important research direction for understanding its evolutionary conservation and adaptive significance. Researchers should approach this question through:

  • Phylogenetic analysis: Comparing CURT1A sequences across diverse plant lineages to identify conserved domains and species-specific adaptations, particularly in plants adapted to different light environments.

  • Environmental response studies: Examining CURT1A expression, localization, and function under varying light intensities, spectral qualities, temperature regimes, and drought conditions.

  • Cross-species complementation: Testing whether CURT1A from one species can rescue phenotypes in CURT1A-deficient mutants of another species, providing insights into functional conservation.

  • Structural plasticity assessment: Investigating how thylakoid membrane architecture regulated by CURT1A changes in response to environmental stresses, particularly focusing on the dynamic remodeling of grana stacks.

  • Quantitative trait analysis: In natural populations or crops, correlating CURT1A sequence variants with photosynthetic efficiency under different environmental conditions.

This multi-faceted approach would reveal whether CURT1A function represents a conserved mechanism in chloroplast development or serves as an adaptive element allowing plants to optimize photosynthetic performance in diverse ecological niches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.