Recombinant Arabidopsis thaliana Uncharacterized protein At4g29660 (EMB2752)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Arabidopsis thaliana Uncharacterized Protein At4g29660 (EMB2752) is a genetic and biochemical entity derived from the model plant Arabidopsis thaliana. It is encoded by the gene AT4G29660, annotated as EMBRYO DEFECTIVE 2752 (EMB2752) in genomic databases . While its precise biological function remains uncharacterized, the gene’s association with embryonic defects suggests potential roles in plant development. This protein has been produced recombinantly for research purposes, enabling structural, functional, and interaction studies.

Gene and Protein Identifiers

AttributeDetail
Gene IDAT4G29660
Protein NameUncharacterized Protein At4g29660 (EMB2752)
LocusChromosome 4, Position 2,965,600–2,966,200 (TAIR10)
Sequence Length103 amino acids
Molecular Weight~11.7 kDa (estimated based on sequence)
UniProt AccessionQ94K18

Sequence:
MQGVWSQLWRKYADYKYNKFERFAVWEMIEPYRRPKTFTTLITIYVAAFYTGVIGAAVTEQLYKEKFWEEHPGKTVPLMKPVFYRGPWRVYRGEAIASDASSQ .

Embryonic Development

The gene’s designation EMB2752 implies a role in embryogenesis, though specific mechanisms are uncharacterized. Mutations in this gene may lead to defective embryo formation, as inferred from phenotypic screens .

Protein Interactions

Recombinant EMB2752 has been studied in the context of Arabidopsis Histidine Kinase 5 (AHK5), a cytosolic ROS sensor involved in stress signaling . Preliminary data suggest potential interactions with AHK5 or related kinases, though functional validation is pending.

Expression Systems

EMB2752 is produced via recombinant expression in heterologous systems, often E. coli or Arabidopsis thaliana itself . The latter platform leverages native post-translational modifications and interaction partners for authentic protein folding .

ParameterDetail
Host SystemE. coli, Arabidopsis thaliana
Purification YieldUp to 0.4 mg/g fresh weight (in Arabidopsis)
Storage BufferTris-based buffer, 50% glycerol
Stability-20°C (long-term), 4°C (short-term)

Research Applications

  • ELISA Detection: Recombinant EMB2752 is used in ELISA kits to quantify protein levels in developmental or stress-response studies .

  • Interaction Studies: In vitro assays explore its binding to AHK5, RBOHD (respiratory burst oxidase homolog D), or other signaling proteins .

Knowledge Gaps

Proposed Research Strategies

  1. Gene Editing: CRISPR-based knockout to study embryonic phenotypes.

  2. Proteomics: Co-IP/MS to identify interaction partners in Arabidopsis.

  3. Structural Biology: X-ray crystallography or cryo-EM to resolve its 3D structure.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference in the order notes. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
EMB2752; At4g29660; T16L4.170; Uncharacterized protein At4g29660; Protein EMBRYO DEFECTIVE 2752
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-103
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
EMB2752
Target Protein Sequence
MQGVWSQLWRKYADYKYNKFERFAVWEMIEPYRRPKTFTTLITIYVAAFYTGVIGAAVTE QLYKEKFWEEHPGKTVPLMKPVFYRGPWRVYRGEAIASDASSQ
Uniprot No.

Target Background

Database Links

KEGG: ath:AT4G29660

STRING: 3702.AT4G29660.1

UniGene: At.19051

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What experimental design would be most effective for initial characterization of At4g29660 (EMB2752)?

For initial characterization of uncharacterized proteins like At4g29660, a multi-faceted approach combining genomics, transcriptomics, and proteomics is recommended. Begin with sequence-based analysis to identify conserved domains and potential orthologs. Arabidopsis thaliana's well-documented polymorphism patterns and genomic resources provide an excellent foundation for this work . For recombinant expression, the seed-specific β-PHASEOLIN (PPHAS) promoter system has proven effective for producing recombinant proteins in Arabidopsis . Complementary approaches should include subcellular localization studies using fluorescent protein tags and co-immunoprecipitation to identify interaction partners.

How can researchers distinguish between technical artifacts and genuine phenotypes when studying EMB2752?

Distinguishing between artifacts and genuine phenotypes requires rigorous experimental controls and replication. When working with embryo-defective (EMB) genes like At4g29660, comparison with wild-type Col-0 is essential, as demonstrated in transcriptomic studies of recombinant protein expression . Implement at least three biological replicates for each experiment. For gene knockout studies, use multiple independent T-DNA insertion lines or CRISPR-Cas9 mutations targeting different regions of the gene. Complementation assays with the wild-type gene sequence provide the gold standard for verifying that observed phenotypes are specifically due to disruption of At4g29660 rather than secondary mutations or off-target effects.

What bioinformatic tools are most appropriate for predicting At4g29660 function?

For uncharacterized proteins like At4g29660, a hierarchical bioinformatic approach is recommended. Begin with sequence-based tools including BLAST, PFAM, and INTERPRO to identify conserved domains and sequence similarities. Structure prediction tools such as AlphaFold2 can provide insights into potential protein function based on predicted three-dimensional structure. For embryo-defective genes, the SeedGenes database (www.seedgenes.org) offers specialized information on embryo-lethal mutations in Arabidopsis. Network-based approaches incorporating co-expression data from platforms like ATTED-II can identify genes with similar expression patterns, suggesting potential functional relationships. These predictions should guide experimental design but must be validated experimentally.

How does the unfolded protein response affect recombinant At4g29660 expression in Arabidopsis?

Recombinant protein production in Arabidopsis seeds can trigger endoplasmic reticulum (ER) stress and the unfolded protein response (UPR), which may affect yields and protein quality. Research has shown that even at antibody accumulation levels of 1% of total soluble seed protein, UPR-related genes are upregulated . For At4g29660, monitoring UPR marker genes such as BIP, PDI, and CALNEXIN is essential when establishing expression systems. Transcriptomic studies of Arabidopsis seeds producing recombinant proteins revealed upregulation of genes related to protein folding, glycosylation/modification, translocation, vesicle transport, and protein degradation . These cellular responses can be managed by co-expression with appropriate chaperones or by targeting the recombinant protein to specific subcellular compartments to minimize ER stress.

What purification strategies are most effective for isolating recombinant At4g29660?

For purification of recombinant At4g29660, a strategic tagging approach combined with optimized extraction conditions is recommended. Fusion tags such as His6, FLAG, or GST can facilitate affinity purification while minimizing interference with protein function. For expression in Arabidopsis seeds, consider the following purification protocol:

Table 1: Optimized Purification Protocol for Seed-Expressed Recombinant Proteins

StepProcedureParametersConsiderations
1. Seed GrindingMechanical disruptionFine powder, liquid N₂Prevent heat denaturation
2. Protein ExtractionBuffer selectionpH 7.5, 150mM NaCl, 0.5% Triton X-100Adjust based on predicted pI
3. ClarificationCentrifugation20,000×g, 30 min, 4°CRemove insoluble material
4. Affinity ChromatographyTag-specific resinFlow rate: 0.5 ml/minOptimize binding/elution conditions
5. Size ExclusionGel filtrationSuperdex 200Assess oligomeric state
6. Quality ControlSDS-PAGE, Western BlotAnti-tag antibodiesVerify purity and integrity

This protocol should be optimized based on the specific properties of At4g29660 and the expression system employed.

What approaches are most suitable for investigating At4g29660's role in embryo development?

To investigate At4g29660's role in embryo development, a systematic phenotypic analysis of mutant embryos is essential. Begin with silique clearing techniques to observe embryo development stages in heterozygous T-DNA insertion lines, as homozygous mutations in embryo-lethal genes cannot be recovered. Document the terminal embryo stage and specific developmental abnormalities. Complementation with fluorescently-tagged At4g29660 under its native promoter can simultaneously rescue the phenotype and reveal the protein's expression pattern during embryogenesis. For molecular insights, use laser-capture microdissection to isolate specific embryonic tissues for transcriptomic analysis, comparing wild-type and mutant embryos. Advanced approaches may include inducible RNAi systems to bypass embryo lethality and study At4g29660 function in specific tissues or developmental stages.

How can researchers resolve contradictory data regarding At4g29660 function?

Resolving contradictory data regarding At4g29660 function requires systematic investigation of potential variables. When facing contradictory results, consider the following methodological approach:

  • Genetic background effects: Arabidopsis ecotypes show significant polymorphism that might affect phenotype penetrance . Repeat experiments in multiple genetic backgrounds.

  • Environmental conditions: Standardize growth conditions (light, temperature, humidity) and document them thoroughly, as these can significantly affect gene expression patterns.

  • Developmental timing: The expression of seed proteins in Arabidopsis follows strict temporal regulation, with major storage proteins accumulating between 8-16 days post anthesis (dpa) . Ensure consistent sampling timepoints.

  • Protein interactions: Uncharacterized proteins may function in complexes with varying composition across tissues or conditions. Use techniques like BioID or proximity labeling to identify context-dependent interaction partners.

  • Redundancy: Check for potential paralogous genes that might mask phenotypes through functional redundancy.

By systematically exploring these variables and using diverse experimental approaches, contradictory data can often be reconciled into a more complete understanding of protein function.

What techniques can reveal At4g29660's protein-protein interaction network?

For mapping At4g29660's protein-protein interaction network, a multi-method approach is recommended to reduce false positives and negatives. Yeast two-hybrid (Y2H) screening provides a high-throughput initial survey of potential interactors but may yield false positives. Co-immunoprecipitation (Co-IP) followed by mass spectrometry offers a more physiologically relevant approach, detecting interactions in planta. For transient or weak interactions, proximity-based labeling techniques such as BioID or APEX2 are advantageous, as they capture proteins that come into proximity with At4g29660 even if the interactions are not stable enough for Co-IP. Bimolecular fluorescence complementation (BiFC) can confirm specific interactions while simultaneously revealing their subcellular context. Each identified interaction should be validated through multiple methods and assessed for biological relevance through genetic studies (e.g., examining phenotypes of double mutants).

How can genome-wide approaches enhance understanding of At4g29660 function?

Genome-wide approaches provide powerful complements to targeted studies of At4g29660. Transcriptomic analysis using RNA-Seq or Tiling arrays can identify genes differentially expressed in At4g29660 mutants compared to wild-type, revealing potential downstream pathways . ChIP-Seq might identify genomic regions associated with At4g29660 if it functions in transcriptional regulation. Metabolomic profiling can detect biochemical changes resulting from At4g29660 disruption, potentially revealing its role in specific metabolic pathways. For proteins involved in embryo development, comparative transcriptomics across different embryonic stages in wild-type versus heterozygous mutants can be particularly informative. The integration of multiple omics datasets using systems biology approaches can place At4g29660 within broader cellular networks, generating hypotheses about its function that can be tested experimentally.

What considerations are important when designing CRISPR-Cas9 experiments for At4g29660 functional studies?

When designing CRISPR-Cas9 experiments for At4g29660 functional studies, several technical and biological considerations are critical. For guide RNA design, select targets with minimal off-target potential, preferably in early exons to maximize disruption probability. Since At4g29660 is embryo-lethal, design conditional knockout strategies using tissue-specific or inducible promoters to drive Cas9 expression. Alternatively, design precision edits that modify specific domains rather than creating null alleles. For embryo-lethal genes, generating mosaic plants through somatic editing can provide insights while bypassing complete lethality. Always include appropriate controls, including Cas9-only and non-targeting guide RNA controls. Validate all edited lines by sequencing both the target site and potential off-target sites, and complement with the wild-type gene to confirm phenotype specificity.

How does population genomics inform evolutionary studies of At4g29660?

Population genomics provides valuable context for understanding At4g29660's evolutionary history and functional constraints. Arabidopsis thaliana shows significant natural variation, with linkage disequilibrium decaying rapidly (within 50 kb) and population structure evident across its range . To leverage this variation for At4g29660 studies:

  • Analyze sequence polymorphism patterns in At4g29660 across Arabidopsis ecotypes. Low polymorphism suggests strong purifying selection and functional importance.

  • Compare nonsynonymous to synonymous substitution ratios (dN/dS) with other genes to assess selective pressure.

  • Examine expression quantitative trait loci (eQTLs) affecting At4g29660 expression levels in different populations.

  • Investigate copy number variations and presence/absence variations across populations.

  • Perform cross-species comparisons to identify conserved domains subject to strong selection.

These approaches can reveal whether At4g29660 shows local adaptation patterns and identify functionally critical regions within the protein.

What strategies can overcome low expression of recombinant At4g29660?

  • Codon optimization for Arabidopsis preferred codons, which can increase translation efficiency.

  • Testing multiple fusion tags and positions (N-terminal, C-terminal) to improve protein stability.

  • Co-expressing molecular chaperones like BiP to facilitate proper protein folding and prevent ER-associated degradation.

  • Using subcellular targeting sequences to direct the protein to compartments where it may accumulate to higher levels.

  • Evaluating different harvest timepoints, as recombinant protein accumulation in seeds follows a specific temporal pattern, with optimal accumulation typically occurring 13-14 days post-anthesis .

  • Screening multiple independent transformation events, as position effects can significantly impact expression levels.

Implementing these strategies systematically while monitoring the unfolded protein response can help achieve optimal expression levels.

How can researchers interpret microarray data for At4g29660 expression studies?

Interpreting microarray data for At4g29660 expression studies requires careful statistical analysis and biological contextualization. When analyzing tiling array data similar to those used in recombinant protein expression studies , follow these guidelines:

  • Apply appropriate normalization methods to account for technical variation across arrays.

  • Use multiple biological replicates (minimum three) to enable robust statistical analysis.

  • Set appropriate significance thresholds and fold-change cutoffs (e.g., 1.8-fold as used in published Arabidopsis studies ).

  • Perform Gene Ontology (GO) enrichment analysis on differentially expressed genes to identify affected biological processes.

  • Validate key expression changes using quantitative PCR (qPCR).

  • Compare expression patterns across different tissues, developmental stages, and stress conditions.

  • Integrate results with publicly available datasets to identify co-regulated genes that may function in the same pathway.

This systematic approach facilitates meaningful interpretation of At4g29660 expression data within its broader biological context.

What quality control measures are essential for ensuring reproducible At4g29660 research?

Ensuring reproducible research on At4g29660 requires comprehensive quality control measures at each experimental stage. For molecular biology work, verify constructs through sequencing and expression validation before proceeding to functional studies. When producing recombinant At4g29660, consistently analyze protein quality by SDS-PAGE, Western blotting, and mass spectrometry to confirm size, integrity, and modifications. For phenotypic analyses, standardize growth conditions and imaging parameters, using quantitative metrics rather than subjective assessments. In omics experiments, include appropriate controls and technical replicates, and validate key findings through independent methods. Maintain detailed records of all experimental conditions, reagent sources, and data processing steps to enable reproduction by other researchers. Finally, implement data management practices that ensure raw data preservation and accessibility, facilitating both internal validation and external reproducibility.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.