Recombinant Arabidopsis thaliana Uncharacterized Protein At4g29660 (EMB2752) is a genetic and biochemical entity derived from the model plant Arabidopsis thaliana. It is encoded by the gene AT4G29660, annotated as EMBRYO DEFECTIVE 2752 (EMB2752) in genomic databases . While its precise biological function remains uncharacterized, the gene’s association with embryonic defects suggests potential roles in plant development. This protein has been produced recombinantly for research purposes, enabling structural, functional, and interaction studies.
| Attribute | Detail |
|---|---|
| Gene ID | AT4G29660 |
| Protein Name | Uncharacterized Protein At4g29660 (EMB2752) |
| Locus | Chromosome 4, Position 2,965,600–2,966,200 (TAIR10) |
| Sequence Length | 103 amino acids |
| Molecular Weight | ~11.7 kDa (estimated based on sequence) |
| UniProt Accession | Q94K18 |
Sequence:
MQGVWSQLWRKYADYKYNKFERFAVWEMIEPYRRPKTFTTLITIYVAAFYTGVIGAAVTEQLYKEKFWEEHPGKTVPLMKPVFYRGPWRVYRGEAIASDASSQ .
The gene’s designation EMB2752 implies a role in embryogenesis, though specific mechanisms are uncharacterized. Mutations in this gene may lead to defective embryo formation, as inferred from phenotypic screens .
Recombinant EMB2752 has been studied in the context of Arabidopsis Histidine Kinase 5 (AHK5), a cytosolic ROS sensor involved in stress signaling . Preliminary data suggest potential interactions with AHK5 or related kinases, though functional validation is pending.
EMB2752 is produced via recombinant expression in heterologous systems, often E. coli or Arabidopsis thaliana itself . The latter platform leverages native post-translational modifications and interaction partners for authentic protein folding .
ELISA Detection: Recombinant EMB2752 is used in ELISA kits to quantify protein levels in developmental or stress-response studies .
Interaction Studies: In vitro assays explore its binding to AHK5, RBOHD (respiratory burst oxidase homolog D), or other signaling proteins .
Gene Editing: CRISPR-based knockout to study embryonic phenotypes.
Proteomics: Co-IP/MS to identify interaction partners in Arabidopsis.
Structural Biology: X-ray crystallography or cryo-EM to resolve its 3D structure.
For initial characterization of uncharacterized proteins like At4g29660, a multi-faceted approach combining genomics, transcriptomics, and proteomics is recommended. Begin with sequence-based analysis to identify conserved domains and potential orthologs. Arabidopsis thaliana's well-documented polymorphism patterns and genomic resources provide an excellent foundation for this work . For recombinant expression, the seed-specific β-PHASEOLIN (PPHAS) promoter system has proven effective for producing recombinant proteins in Arabidopsis . Complementary approaches should include subcellular localization studies using fluorescent protein tags and co-immunoprecipitation to identify interaction partners.
Distinguishing between artifacts and genuine phenotypes requires rigorous experimental controls and replication. When working with embryo-defective (EMB) genes like At4g29660, comparison with wild-type Col-0 is essential, as demonstrated in transcriptomic studies of recombinant protein expression . Implement at least three biological replicates for each experiment. For gene knockout studies, use multiple independent T-DNA insertion lines or CRISPR-Cas9 mutations targeting different regions of the gene. Complementation assays with the wild-type gene sequence provide the gold standard for verifying that observed phenotypes are specifically due to disruption of At4g29660 rather than secondary mutations or off-target effects.
For uncharacterized proteins like At4g29660, a hierarchical bioinformatic approach is recommended. Begin with sequence-based tools including BLAST, PFAM, and INTERPRO to identify conserved domains and sequence similarities. Structure prediction tools such as AlphaFold2 can provide insights into potential protein function based on predicted three-dimensional structure. For embryo-defective genes, the SeedGenes database (www.seedgenes.org) offers specialized information on embryo-lethal mutations in Arabidopsis. Network-based approaches incorporating co-expression data from platforms like ATTED-II can identify genes with similar expression patterns, suggesting potential functional relationships. These predictions should guide experimental design but must be validated experimentally.
Recombinant protein production in Arabidopsis seeds can trigger endoplasmic reticulum (ER) stress and the unfolded protein response (UPR), which may affect yields and protein quality. Research has shown that even at antibody accumulation levels of 1% of total soluble seed protein, UPR-related genes are upregulated . For At4g29660, monitoring UPR marker genes such as BIP, PDI, and CALNEXIN is essential when establishing expression systems. Transcriptomic studies of Arabidopsis seeds producing recombinant proteins revealed upregulation of genes related to protein folding, glycosylation/modification, translocation, vesicle transport, and protein degradation . These cellular responses can be managed by co-expression with appropriate chaperones or by targeting the recombinant protein to specific subcellular compartments to minimize ER stress.
For purification of recombinant At4g29660, a strategic tagging approach combined with optimized extraction conditions is recommended. Fusion tags such as His6, FLAG, or GST can facilitate affinity purification while minimizing interference with protein function. For expression in Arabidopsis seeds, consider the following purification protocol:
| Step | Procedure | Parameters | Considerations |
|---|---|---|---|
| 1. Seed Grinding | Mechanical disruption | Fine powder, liquid N₂ | Prevent heat denaturation |
| 2. Protein Extraction | Buffer selection | pH 7.5, 150mM NaCl, 0.5% Triton X-100 | Adjust based on predicted pI |
| 3. Clarification | Centrifugation | 20,000×g, 30 min, 4°C | Remove insoluble material |
| 4. Affinity Chromatography | Tag-specific resin | Flow rate: 0.5 ml/min | Optimize binding/elution conditions |
| 5. Size Exclusion | Gel filtration | Superdex 200 | Assess oligomeric state |
| 6. Quality Control | SDS-PAGE, Western Blot | Anti-tag antibodies | Verify purity and integrity |
This protocol should be optimized based on the specific properties of At4g29660 and the expression system employed.
To investigate At4g29660's role in embryo development, a systematic phenotypic analysis of mutant embryos is essential. Begin with silique clearing techniques to observe embryo development stages in heterozygous T-DNA insertion lines, as homozygous mutations in embryo-lethal genes cannot be recovered. Document the terminal embryo stage and specific developmental abnormalities. Complementation with fluorescently-tagged At4g29660 under its native promoter can simultaneously rescue the phenotype and reveal the protein's expression pattern during embryogenesis. For molecular insights, use laser-capture microdissection to isolate specific embryonic tissues for transcriptomic analysis, comparing wild-type and mutant embryos. Advanced approaches may include inducible RNAi systems to bypass embryo lethality and study At4g29660 function in specific tissues or developmental stages.
Resolving contradictory data regarding At4g29660 function requires systematic investigation of potential variables. When facing contradictory results, consider the following methodological approach:
Genetic background effects: Arabidopsis ecotypes show significant polymorphism that might affect phenotype penetrance . Repeat experiments in multiple genetic backgrounds.
Environmental conditions: Standardize growth conditions (light, temperature, humidity) and document them thoroughly, as these can significantly affect gene expression patterns.
Developmental timing: The expression of seed proteins in Arabidopsis follows strict temporal regulation, with major storage proteins accumulating between 8-16 days post anthesis (dpa) . Ensure consistent sampling timepoints.
Protein interactions: Uncharacterized proteins may function in complexes with varying composition across tissues or conditions. Use techniques like BioID or proximity labeling to identify context-dependent interaction partners.
Redundancy: Check for potential paralogous genes that might mask phenotypes through functional redundancy.
By systematically exploring these variables and using diverse experimental approaches, contradictory data can often be reconciled into a more complete understanding of protein function.
For mapping At4g29660's protein-protein interaction network, a multi-method approach is recommended to reduce false positives and negatives. Yeast two-hybrid (Y2H) screening provides a high-throughput initial survey of potential interactors but may yield false positives. Co-immunoprecipitation (Co-IP) followed by mass spectrometry offers a more physiologically relevant approach, detecting interactions in planta. For transient or weak interactions, proximity-based labeling techniques such as BioID or APEX2 are advantageous, as they capture proteins that come into proximity with At4g29660 even if the interactions are not stable enough for Co-IP. Bimolecular fluorescence complementation (BiFC) can confirm specific interactions while simultaneously revealing their subcellular context. Each identified interaction should be validated through multiple methods and assessed for biological relevance through genetic studies (e.g., examining phenotypes of double mutants).
Genome-wide approaches provide powerful complements to targeted studies of At4g29660. Transcriptomic analysis using RNA-Seq or Tiling arrays can identify genes differentially expressed in At4g29660 mutants compared to wild-type, revealing potential downstream pathways . ChIP-Seq might identify genomic regions associated with At4g29660 if it functions in transcriptional regulation. Metabolomic profiling can detect biochemical changes resulting from At4g29660 disruption, potentially revealing its role in specific metabolic pathways. For proteins involved in embryo development, comparative transcriptomics across different embryonic stages in wild-type versus heterozygous mutants can be particularly informative. The integration of multiple omics datasets using systems biology approaches can place At4g29660 within broader cellular networks, generating hypotheses about its function that can be tested experimentally.
When designing CRISPR-Cas9 experiments for At4g29660 functional studies, several technical and biological considerations are critical. For guide RNA design, select targets with minimal off-target potential, preferably in early exons to maximize disruption probability. Since At4g29660 is embryo-lethal, design conditional knockout strategies using tissue-specific or inducible promoters to drive Cas9 expression. Alternatively, design precision edits that modify specific domains rather than creating null alleles. For embryo-lethal genes, generating mosaic plants through somatic editing can provide insights while bypassing complete lethality. Always include appropriate controls, including Cas9-only and non-targeting guide RNA controls. Validate all edited lines by sequencing both the target site and potential off-target sites, and complement with the wild-type gene to confirm phenotype specificity.
Population genomics provides valuable context for understanding At4g29660's evolutionary history and functional constraints. Arabidopsis thaliana shows significant natural variation, with linkage disequilibrium decaying rapidly (within 50 kb) and population structure evident across its range . To leverage this variation for At4g29660 studies:
Analyze sequence polymorphism patterns in At4g29660 across Arabidopsis ecotypes. Low polymorphism suggests strong purifying selection and functional importance.
Compare nonsynonymous to synonymous substitution ratios (dN/dS) with other genes to assess selective pressure.
Examine expression quantitative trait loci (eQTLs) affecting At4g29660 expression levels in different populations.
Investigate copy number variations and presence/absence variations across populations.
Perform cross-species comparisons to identify conserved domains subject to strong selection.
These approaches can reveal whether At4g29660 shows local adaptation patterns and identify functionally critical regions within the protein.
Codon optimization for Arabidopsis preferred codons, which can increase translation efficiency.
Testing multiple fusion tags and positions (N-terminal, C-terminal) to improve protein stability.
Co-expressing molecular chaperones like BiP to facilitate proper protein folding and prevent ER-associated degradation.
Using subcellular targeting sequences to direct the protein to compartments where it may accumulate to higher levels.
Evaluating different harvest timepoints, as recombinant protein accumulation in seeds follows a specific temporal pattern, with optimal accumulation typically occurring 13-14 days post-anthesis .
Screening multiple independent transformation events, as position effects can significantly impact expression levels.
Implementing these strategies systematically while monitoring the unfolded protein response can help achieve optimal expression levels.
Interpreting microarray data for At4g29660 expression studies requires careful statistical analysis and biological contextualization. When analyzing tiling array data similar to those used in recombinant protein expression studies , follow these guidelines:
Apply appropriate normalization methods to account for technical variation across arrays.
Use multiple biological replicates (minimum three) to enable robust statistical analysis.
Set appropriate significance thresholds and fold-change cutoffs (e.g., 1.8-fold as used in published Arabidopsis studies ).
Perform Gene Ontology (GO) enrichment analysis on differentially expressed genes to identify affected biological processes.
Validate key expression changes using quantitative PCR (qPCR).
Compare expression patterns across different tissues, developmental stages, and stress conditions.
Integrate results with publicly available datasets to identify co-regulated genes that may function in the same pathway.
This systematic approach facilitates meaningful interpretation of At4g29660 expression data within its broader biological context.
Ensuring reproducible research on At4g29660 requires comprehensive quality control measures at each experimental stage. For molecular biology work, verify constructs through sequencing and expression validation before proceeding to functional studies. When producing recombinant At4g29660, consistently analyze protein quality by SDS-PAGE, Western blotting, and mass spectrometry to confirm size, integrity, and modifications. For phenotypic analyses, standardize growth conditions and imaging parameters, using quantitative metrics rather than subjective assessments. In omics experiments, include appropriate controls and technical replicates, and validate key findings through independent methods. Maintain detailed records of all experimental conditions, reagent sources, and data processing steps to enable reproduction by other researchers. Finally, implement data management practices that ensure raw data preservation and accessibility, facilitating both internal validation and external reproducibility.