Recombinant Arabidopsis thaliana Uncharacterized protein At5g03900, chloroplastic (At5g03900)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
At5g03900; F8F6_110; MED24.20; Uncharacterized protein At5g03900, chloroplastic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
63-523
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At5g03900
Target Protein Sequence
AASLDKVSGAIKPGGLVESDKLPTDVRKRAMDAVDECGRRVTVGDVASRGGLKVTEAQTA LQAIAADTDGFLEVSDEGDVLYVFPRDYRTKLAAKSLRIQIEPFLEKAKGAVDYLARVSF GTALIASIVIVYTSIIALLSSKSEDDNRQRRRGRSYDSGFNFYINPVDLLWYWDPNYYNR RRAREDEGKGMNFIESVFSFVFGDGDPNQGIEEERWQMIGQYITSRGGVVAADELAPYLD VPSSKSAMNDESYILPVLLRFDGQPELDEEGNILYCFPSLQRTASGSSRRKEYVGKWFDW VADMEKFFKEKKWQFSKTSTSERALVIGLGAVNLFGVIVLNTLLNEMSVRPGGFLTFVKN IYPLLQIYAGSFFTIPLIRWFSIKRKNNQIENRNKARLQFARALESPDIALRRKLLSARD MAQKTVIGKDRIVYSTDRDMMEQNYETDEWDRRFKELEKSD
Uniprot No.

Target Background

Database Links

KEGG: ath:AT5G03900

STRING: 3702.AT5G03900.2

UniGene: At.33208

Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.

Q&A

Is there evidence for homologous proteins in other plant species?

Yes, homologous proteins have been identified in other plant species, most notably in Nicotiana tomentosiformis (tobacco family), where it is designated as LOC108949139 . Comparative sequence analysis reveals significant conservation, suggesting an important biological function that has been maintained throughout plant evolution.

The table below summarizes key homologous proteins identified across different plant species:

SpeciesGene/Protein IdentifierSimilarity (%)Evidence Type
Nicotiana tomentosiformisLOC108949139~85%Genomic sequencing
Arabidopsis thalianaAt5g03900100% (reference)Multiple sources

When designing experiments with At5g03900, researchers should consider cross-species conservation as it may provide valuable insights into functional domains and evolutionary significance.

What are the optimal conditions for expressing recombinant At5g03900 protein?

For optimal expression of recombinant At5g03900, the evidence suggests using E. coli expression systems with His-tag fusion proteins. Based on published protocols, recommended conditions include:

  • Expression Vector: Use pET-based vectors with His-tag (preferably N-terminal) for ease of purification

  • Expression Strain: BL21(DE3) or Rosetta strains are effective for chloroplastic proteins

  • Induction Parameters: 0.5-1.0 mM IPTG at OD600 of 0.6-0.8

  • Temperature: Reduce to 18-20°C post-induction to enhance protein folding

  • Duration: Extended expression (16-20 hours) at lower temperatures typically yields better results

When working with this chloroplastic protein, researchers should consider the potential for inclusion body formation, which may necessitate optimizing solubilization conditions during purification .

What purification strategy yields the highest purity for functional studies?

To obtain high-purity At5g03900 protein suitable for functional studies, a multi-stage purification approach is recommended:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with stepwise imidazole elution (20-250 mM gradient)

  • Secondary Purification: Size exclusion chromatography to separate aggregates and monomeric forms

  • Buffer Optimization: Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been demonstrated to maintain stability

For long-term storage, adding glycerol to a final concentration of 50% and storing at -20°C or -80°C in aliquots prevents repeated freeze-thaw cycles, which can significantly reduce activity .

Purification StepConditionsExpected PurityNotes
IMAC20-250 mM imidazole gradient>80%Remove imidazole before secondary purification
Size ExclusionSuperdex 200 column>90%Separates oligomeric forms
Final PreparationAdd 50% glycerol>95%Aliquot to prevent freeze-thaw cycles

How can I design effective T-DNA insertion mutants to study At5g03900 function?

Designing effective T-DNA insertion mutants requires strategic targeting of the At5g03900 gene to maximize the probability of complete functional disruption. Based on established protocols for Arabidopsis T-DNA insertional mutants:

  • Target Selection: Prioritize insertions within coding sequences (CDS) rather than promoter or UTR regions, as these have a 90% success rate for gene knockout compared to only 25% for promoter insertions

  • Homozygous Line Isolation: Use a two-step PCR genotyping approach:

    • PCR 1: GSP pair spanning insertion site to detect WT allele

    • PCR 2: GSP + T-DNA border primer to detect insertion

  • Functional Validation: Confirm knockout by RT-PCR and/or Western blot analysis

When selecting lines from repositories like ABRC or NASC, prioritize insertions in exons over those in introns or untranslated regions for higher probability of complete gene disruption .

What transcriptomic approaches would be most informative for understanding At5g03900 function?

To understand At5g03900 function through transcriptomics, researchers should consider both global and targeted approaches:

  • Differential Expression Analysis: Compare transcriptomes of wild-type and At5g03900 knockout/knockdown plants under various conditions to identify affected pathways. RNA-seq is preferred over microarray due to its higher sensitivity and unbiased nature .

  • Co-expression Network Analysis: Identify genes that show correlated expression patterns with At5g03900 across diverse conditions to infer functional relationships.

  • Stress Response Profiling: Given that chloroplastic proteins often respond to environmental stressors, analyze expression under various stress conditions (light intensity, temperature, space flight conditions) as described in recent Arabidopsis studies .

  • Tissue-Specific Expression: Considering the potential role in iron-sulfur cluster biosynthesis, examine expression across different developmental stages and plant tissues.

For RNA-seq experimental design, a minimum of 3-4 biological replicates per condition is recommended, with sequencing depth of at least 20 million reads per sample to detect moderate to low-abundance transcripts .

How might At5g03900 interact with chloroplastic gene expression and RNA processing?

Recent studies on chloroplastic proteins suggest potential roles in RNA processing and gene expression regulation. For At5g03900, consider the following methodological approaches:

  • RNA Immunoprecipitation (RIP): If At5g03900 binds RNA, RIP using antibodies against the tagged protein can identify target transcripts. This should be coupled with RNA-seq (RIP-seq) for comprehensive identification.

  • RNA End Mapping: Given the potential role in RNA processing, mapping transcript termini through techniques like 5' and 3' RACE in wild-type versus mutant plants can reveal alterations in RNA processing .

  • Ribosome Profiling: To assess impacts on translation efficiency within chloroplasts, ribosome profiling comparing wild-type and mutant plants may reveal translational regulation changes.

Evidence from chloroplast RNA processing pathways suggests that proteins involved in RNA metabolism often affect 5' and 3' end maturation, potentially through exonucleolytic trimming until a prescribed position determined by RNA structure or protein binding sites . If At5g03900 functions in RNA metabolism, expect changes in transcript termini mapping in mutant plants.

What approaches can determine if At5g03900 is involved in epigenetic regulation in chloroplasts?

Recent work has identified roles for chloroplastic proteins in epigenetic processes. To investigate At5g03900's potential involvement:

  • Chromatin Immunoprecipitation (ChIP): If At5g03900 associates with DNA, perform ChIP followed by sequencing (ChIP-seq) to identify genomic binding sites.

  • Bisulfite Sequencing: Compare DNA methylation patterns between wild-type and At5g03900 mutant plants to detect changes in cytosine methylation patterns.

  • Small RNA Analysis: Analyze changes in small RNA populations, particularly 24-nt sRNAs involved in RNA-directed DNA methylation pathway .

Research on small RNA-guided histone methylation in Arabidopsis has revealed complex mechanisms involving proteins that direct histone H3 lysine 9 dimethylation during embryonic development . If At5g03900 functions in this pathway, mutant analysis may reveal changes in H3K9me2 patterns at small RNA target loci.

How can I overcome solubility issues when working with recombinant At5g03900?

Chloroplastic proteins often present solubility challenges. To improve solubility of recombinant At5g03900:

  • Expression Optimization:

    • Reduce induction temperature to 16-18°C

    • Use lower IPTG concentrations (0.1-0.3 mM)

    • Test different E. coli strains (Arctic Express, SHuffle)

  • Fusion Partners: Consider solubility-enhancing fusion partners:

    • MBP (maltose-binding protein)

    • SUMO

    • Thioredoxin

  • Buffer Optimization:

    • Include stabilizing agents: 6% trehalose, 5-10% glycerol

    • Test different pH ranges (7.5-8.5)

    • Include reducing agents (2-5 mM DTT or β-mercaptoethanol)

  • Refolding Strategies: If inclusion bodies form, develop a refolding protocol:

    • Solubilize in 6M guanidinium hydrochloride or 8M urea

    • Gradually remove denaturant through dialysis or column-based methods

    • Include chaperone proteins during refolding

Experimental evidence suggests that Tris/PBS-based buffer with 6% trehalose at pH 8.0 is effective for maintaining At5g03900 stability .

What are the best strategies for designing research questions around an uncharacterized protein?

When designing research questions for uncharacterized proteins like At5g03900, apply these methodological principles:

  • Start with Comparative Analysis:

    • Conduct thorough sequence homology searches across species

    • Identify conserved domains and motifs that suggest function

    • Compare expression patterns with proteins of known function

  • Develop Clear, Testable Hypotheses:

    • Formulate concise questions based on predicted functional categories

    • Ensure questions are open-ended but specific enough to guide experimental design

    • Example: "How does At5g03900 affect iron homeostasis in chloroplasts?" rather than "What does At5g03900 do?"

  • Apply Multi-Omics Approaches:

    • Integrate transcriptomics, proteomics, and metabolomics data

    • Look for correlations across different data types

    • Prioritize hypotheses supported by multiple data types

  • Plan for Iterative Refinement:

    • Design initial experiments to narrow the functional space

    • Use results to refine subsequent experiments

    • Document negative results to avoid redundant efforts

Following principles from qualitative research methodology, the "abductive analysis" approach is particularly valuable - allowing for theoretical insights to emerge from unexpected findings during experimental work .

How might At5g03900 function in stress response pathways in Arabidopsis?

Recent transcriptomic studies of Arabidopsis under various stress conditions provide a framework for investigating At5g03900's potential role in stress responses:

  • Spaceflight Response: Comparative transcriptomic analysis of 15 Arabidopsis spaceflight experiments revealed distinct gene expression patterns related to microgravity adaptation . To investigate At5g03900's role:

    • Compare expression levels across ground control and spaceflight samples

    • Analyze knockout/knockdown mutant phenotypes under simulated microgravity

    • Examine protein localization changes under stress conditions

  • Oxidative Stress: Given its chloroplastic localization and potential role in iron-sulfur cluster biosynthesis, At5g03900 may function in oxidative stress response:

    • Challenge mutant plants with ROS-inducing compounds

    • Measure photosynthetic efficiency under oxidative stress

    • Analyze redox-sensitive protein modifications

  • Light Stress Response: Chloroplastic proteins often function in light signaling and photoprotection:

    • Compare wild-type and mutant responses to high light intensity

    • Analyze non-photochemical quenching capacity

    • Monitor chloroplast ultrastructure under varying light conditions

When designing these experiments, ensure proper control of environmental variables and use standardized growth conditions to minimize experimental variation across studies .

Could At5g03900 play a role in floral development through epigenetic regulation?

While At5g03900 is chloroplastic, emerging research suggests connections between chloroplast function and developmental processes through retrograde signaling. To investigate potential roles in floral development:

  • Expression Analysis:

    • Examine At5g03900 expression patterns during floral transition

    • Compare with expression of key floral regulators like SEPALLATA genes

    • Analyze in different floral organ tissues

  • Mutant Phenotyping:

    • Carefully characterize knockout/knockdown plants under normal and elevated growth conditions

    • Focus on subtle phenotypes that may only manifest under specific conditions

    • Look for non-redundant functions affecting floral organs

  • Epigenetic Landscape Analysis:

    • Compare histone modification patterns (particularly H3K9me2) in wild-type versus mutant plants

    • Focus on regulatory regions of key developmental genes

    • Analyze small RNA populations that may direct epigenetic modifications

Research on SEPALLATA genes in Arabidopsis has demonstrated non-redundant functions affecting all floral organs, especially under elevated growth conditions . If At5g03900 plays a role in epigenetic regulation, it may influence floral development through similar mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.