Recombinant Arabidopsis thaliana Uncharacterized protein At5g19025 (At5g19025)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparations.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
At5g19025; T16G12_60; Uncharacterized protein At5g19025
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-259
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At5g19025
Target Protein Sequence
MLHLFLFSSAASTTTAVEDNSTTMPPSSRSAANQNSSSSLHLCKHSPSATLDLLILILVL FSGTFLLSSYFSYLIHSLSLLSSHFPSITISLSSLLPPLIIFFSSDHSTEDEDHHHPSGK IPPPASFFFAFAVFFAASIAFLDLCCGSRSRKCRNPKCKGMKKAMEFDLQLQTEECVKSG SVKEIDRLPWKGGSESNPDYECLRAELRKMAPVNGRAVLIFRSKCGCPIAKLEGWGPKRS RRHKKSPAKLAVKGCIDNR
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is known about the basic properties of the At5g19025 protein?

At5g19025 is an uncharacterized protein from Arabidopsis thaliana with a full-length sequence of 259 amino acids. The protein is available in recombinant form with a histidine tag, typically expressed in E. coli expression systems . Despite being categorized as "uncharacterized," preliminary structural analyses suggest it may have conserved domains that could provide clues to its potential function. Standard characterization should include SDS-PAGE analysis for molecular weight confirmation, circular dichroism for secondary structure assessment, and thermal shift assays to evaluate stability under different buffer conditions.

What experimental approaches are most suitable for initial characterization of At5g19025?

Initial characterization should follow a systematic workflow:

  • Expression optimization in E. coli systems using different temperatures, induction times, and media compositions

  • Purification via nickel affinity chromatography followed by size exclusion chromatography

  • Basic biophysical characterization including:

    • Protein stability assessment across pH range 5.0-9.0

    • Thermal stability analysis using differential scanning fluorimetry

    • Secondary structure analysis via circular dichroism

    • Quaternary structure analysis via analytical ultracentrifugation

These approaches provide foundational data necessary before proceeding to more complex functional analyses .

How should I design experiments to investigate the potential function of At5g19025 in Arabidopsis?

When working with uncharacterized proteins like At5g19025, a multi-faceted experimental design is recommended:

Experimental ApproachKey MethodologyExpected Outcomes
Genetic knockout/knockdownCRISPR-Cas9 or T-DNA insertion linesPhenotypic changes indicating functional role
Overexpression studiesTransgenic lines with constitutive or inducible promotersGain-of-function phenotypes
Subcellular localizationGFP/YFP fusion proteinsCompartment-specific localization
Interactome analysisYeast two-hybrid or co-immunoprecipitationPotential binding partners
Transcriptome analysisRNA-Seq of knockout vs. wild-typeCo-regulated genes and pathways

A robust experimental design should include appropriate controls, with wild-type Arabidopsis serving as the primary control. For transgenic experiments, include both positive controls (known genes with characterized effects) and negative controls (empty vector transformants) . The experimental design should account for biological replication (minimum n=3 for each genotype) and technical replication to ensure statistical robustness.

What statistical approaches are most appropriate for analyzing phenotypic data in At5g19025 studies?

When analyzing phenotypic data from experiments involving At5g19025 mutants or transgenic lines, consider the following statistical approaches:

  • For continuous variables (e.g., fruit length, plant height), use ANOVA followed by post-hoc tests (Tukey's HSD) when comparing multiple genotypes

  • For blocked designs, employ a mixed-effects model that accounts for both fixed effects (genotype) and random effects (block)

  • For time-series data, consider repeated measures ANOVA or linear mixed models

  • For non-normally distributed data, apply appropriate transformations or non-parametric alternatives

Remember that properly blocked experimental designs are crucial for controlling environmental variability. In the case of Arabidopsis studies, T2 plants derived from the same T1 parent constitute a natural blocking factor, as they share the same insertion event . This blocking structure should be incorporated into your statistical analysis to properly account for genetic relationships among experimental units.

How can I identify potential interaction partners of At5g19025?

To identify potential interaction partners of the uncharacterized At5g19025 protein, employ a multi-method approach:

  • In silico prediction: Use tools like STRING, MINT, or Arabidopsis Interactions Viewer to predict interactions based on co-expression, genomic context, and homology to known interacting proteins

  • Yeast two-hybrid screening: Construct bait vectors using the full-length At5g19025 and screen against Arabidopsis cDNA libraries

  • Co-immunoprecipitation coupled with mass spectrometry: Express epitope-tagged At5g19025 in Arabidopsis, perform pull-downs, and identify co-precipitating proteins

  • Proximity-dependent biotin identification (BioID): Fuse At5g19025 to a biotin ligase to biotinylate proximal proteins in vivo

  • Split-GFP complementation assays: Validate candidate interactions in planta using bimolecular fluorescence complementation

When analyzing potential interactors, prioritize proteins with functional annotations related to the observed phenotypes of At5g19025 mutants. Consider the subcellular localization data to filter out unlikely interactions based on cellular compartmentalization .

What approaches can determine if At5g19025 is involved in protein degradation pathways?

Given that protein degradation pathways are important regulatory mechanisms in Arabidopsis, investigate At5g19025's potential role using these approaches:

  • Glycan-dependent degradation analysis: Test if At5g19025 contains N-glycosylation sites that might serve as degradation signals. The evolutionarily conserved N-glycan-dependent ERAD (Endoplasmic Reticulum-Associated Degradation) pathway in Arabidopsis involves specific mannose residues that act as degradation signals

  • Proteasome inhibition studies: Treat plants expressing tagged At5g19025 with proteasome inhibitors (MG132) and analyze protein accumulation patterns

  • Ubiquitination assays: Perform immunoprecipitation followed by ubiquitin-specific western blotting to detect potential ubiquitination of At5g19025

  • Half-life determination: Conduct cycloheximide chase experiments to measure the turnover rate of At5g19025 in different genetic backgrounds

  • Genetic interaction studies: Cross At5g19025 mutants with plants defective in ERAD components like EBS3 (ALG9 ortholog) or EBS4, which are involved in N-glycan assembly and protein quality control

Remember that proper controls are essential, including known ERAD substrates like the bri1-9 variant of the BRASSINOSTEROID-INSENSITIVE 1 receptor, which is retained in the ER and degraded through N-glycan-dependent ERAD pathways .

How can CRISPR-Cas9 genome editing be optimized for studying At5g19025 function?

For CRISPR-Cas9 genome editing of At5g19025, consider these optimization strategies:

  • Guide RNA design: Select highly specific gRNAs targeting conserved domains or the start of the coding sequence. Use tools like CRISPR-P 2.0 specifically optimized for Arabidopsis genome editing to minimize off-target effects

  • Delivery method optimization:

    • Agrobacterium-mediated transformation efficiency varies by Arabidopsis ecotype (Col-0 typically performs best)

    • Floral dip transformation should be performed when approximately 30% of flowers are open

  • Mutation screening protocol:

    • Design a high-throughput PCR-based screening methodology using primers flanking the expected cut site

    • Implement T7 endonuclease I assay or heteroduplex mobility assay for initial screening

    • Confirm mutations by Sanger sequencing

  • Phenotypic analysis workflow:

    • Screen T1 transformants for insertion of CRISPR construct

    • Analyze T2 plants for segregation of mutations

    • Select homozygous knockout lines in the T3 generation for comprehensive phenotyping

  • Complementation strategy:

    • Prepare constructs expressing the wild-type At5g19025 under native promoter

    • Transform knockout lines to confirm phenotype rescue

For successful knockout generation, design multiple gRNAs targeting different exons to increase the likelihood of functional disruption. Analyze at least 10-15 independent knockout lines to account for potential insertion site effects and background mutations .

What are the most informative transcriptomic approaches to understand At5g19025 function?

To gain comprehensive insights into At5g19025 function through transcriptomic analysis:

  • Experimental design considerations:

    • Compare transcriptomes of knockout/knockdown lines vs. wild-type under multiple conditions

    • Include developmental time course to capture temporal regulation

    • Consider tissue-specific profiling (roots, leaves, reproductive organs)

    • Include environmental stress treatments to identify condition-specific functions

  • RNA-Seq methodology optimization:

    • Minimum biological replication: n=3-4 per genotype/condition

    • Sequencing depth: 20-30 million paired-end reads per sample

    • Strand-specific library preparation for detection of antisense transcription

  • Data analysis workflow:

    • Quality control using FastQC followed by adapter/quality trimming

    • Alignment to Arabidopsis reference genome (TAIR10)

    • Differential expression analysis using DESeq2 or edgeR

    • Gene Ontology and pathway enrichment analysis

    • Co-expression network construction

  • Integration with other data types:

    • Combine with proteomics data to identify post-transcriptional regulation

    • Integrate with chromatin accessibility data (ATAC-seq) for regulatory insights

    • Compare with published transcriptome datasets to place At5g19025 in known regulatory networks

For analyzing complex interactions in transcriptomic data, implement weighted gene co-expression network analysis (WGCNA) to identify modules of co-regulated genes that might share function with At5g19025 .

What strategies can address protein solubility issues with recombinant At5g19025?

Recombinant protein expression often faces solubility challenges. For At5g19025, consider these systematic troubleshooting approaches:

  • Expression system optimization:

    • Test multiple E. coli strains (BL21(DE3), Rosetta, Arctic Express)

    • Consider alternate expression systems (yeast, insect cells) if bacterial expression fails

    • Optimize induction parameters (temperature, IPTG concentration, induction time)

  • Construct modification strategies:

    • Express protein fragments rather than full-length protein

    • Remove predicted disordered regions

    • Use solubility-enhancing fusion partners (MBP, SUMO, TRX)

    • Introduce surface entropy reduction mutations

  • Buffer optimization matrix:

    • Screen pH range (5.0-9.0, 0.5 unit increments)

    • Test various salt concentrations (50-500 mM)

    • Evaluate stabilizing additives (glycerol, arginine, trehalose)

    • Include mild detergents for membrane-associated proteins

  • Refolding protocols (if inclusion bodies form):

    • Solubilize in 8M urea or 6M guanidine HCl

    • Use step-wise dialysis for gradual refolding

    • Test on-column refolding during affinity purification

How can I determine if phenotypic changes in At5g19025 mutants are direct effects or pleiotropic consequences?

Distinguishing direct from pleiotropic effects in uncharacterized protein studies requires a comprehensive approach:

  • Multiple allele analysis:

    • Examine multiple independent knockout or knockdown lines

    • Use allelic series (weak to strong) to identify dose-dependent effects

    • Create point mutations in key domains rather than complete knockouts

  • Tissue-specific and inducible expression systems:

    • Employ tissue-specific promoters to restrict complementation

    • Use inducible systems (estrogen, dexamethasone, or ethanol-inducible) to control timing of expression

    • Monitor phenotype rescue timing after induction

  • Biochemical validation:

    • Perform in vitro assays to test biochemical function directly

    • Use purified components to reconstitute proposed activity

    • Introduce structure-based mutations to disrupt specific activities while preserving protein folding

  • Data integration approach:

    • Cross-reference phenotypes with expression patterns

    • Compare temporal appearance of primary vs. secondary effects

    • Use metabolomics to identify direct biochemical perturbations

When analyzing experimental data, create interaction plots to visualize potential relationships between At5g19025 genotype and environmental or developmental factors. Non-parallel lines in these plots suggest interactions between factors and can help identify context-dependent functions of At5g19025 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.