Recombinant Arabidopsis thaliana Uncharacterized protein At5g23160 (At5g23160)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for guaranteed fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Advance notification is required for dry ice shipments, and additional charges will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its use in production.
Synonyms
At5g23160; MKD15.2; Uncharacterized protein At5g23160
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At5g23160
Target Protein Sequence
MGKPERKVRERINSSSSYFLRCFGVSRKIHSDKPIVDAGQEIQKTKKKTRTRWFSRPTKF RSKEEITPTSIYKSEKQKLTFEDDKQNLFRVIRHVTDRKNVATSGYKTVDHETKEKDTNE QRDINPEPLSFLGYDDKFYERVSTDGKLDPTNIVGSGSKPKEIREKSSRVRKRSRVSKLD PVIGISIIMLTLMIMLTWGRLCAILCTSTWCYIFPRLKEAATAVAVVNRKRSGSGKGEEG SFQGDLDLNSVAYKKKVVLEGFLVRQHRVSM
Uniprot No.

Target Background

Database Links

KEGG: ath:AT5G23160

UniGene: At.51064

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How should recombinant At5g23160 protein be stored and reconstituted for experiments?

Recombinant At5g23160 protein should be stored at -20°C or -80°C upon receipt, with aliquoting necessary for multiple uses to avoid repeated freeze-thaw cycles. The lyophilized protein powder should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) to enable long-term storage at -20°C/-80°C. Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided as it may affect protein stability and activity .

What expression systems are typically used for At5g23160 recombinant protein production?

E. coli is the predominant expression system used for producing recombinant At5g23160 protein. The protein is typically expressed with an N-terminal His tag to facilitate purification. The His-tagged protein maintains the full-length sequence (1-271 amino acids) and can be purified to greater than 90% purity as determined by SDS-PAGE . Alternative expression systems have not been widely documented in the literature for this specific protein, though other plant proteins have been successfully expressed in yeast, insect cells, or plant-based expression systems.

How should I design experiments to investigate the potential function of the uncharacterized At5g23160 protein?

Designing experiments to investigate the function of an uncharacterized protein like At5g23160 requires a multifaceted approach:

  • Sequence analysis and structural prediction: Begin with bioinformatic analysis to identify conserved domains, structural features, and potential functional motifs. The amino acid sequence suggests membrane-spanning regions and possible signaling motifs that could inform functional hypotheses .

  • Expression pattern analysis: Determine when and where the gene is expressed using techniques like qRT-PCR, RNA-seq, or reporter gene constructs to identify tissues, developmental stages, or conditions where the protein may function.

  • Protein interaction studies: Use techniques like yeast two-hybrid screening or co-immunoprecipitation to identify potential interacting partners. The methodologies used to identify G-protein interactions in Arabidopsis could serve as a model, as demonstrated in the identification of the γ-subunit .

  • Loss-of-function and gain-of-function studies: Generate knockout or knockdown mutants and overexpression lines to observe phenotypic changes that might reveal function. Consider environmental variables and stressors in your experimental design, as protein function may only become apparent under specific conditions .

  • Subcellular localization: Determine the protein's location within the cell using fluorescent protein fusions or immunolocalization.

When designing these experiments, it's crucial to include appropriate controls and account for variability to ensure reliable and reproducible results .

What controls should be included when studying At5g23160 protein function in stress response pathways?

When investigating the potential role of At5g23160 in stress response pathways, the following controls should be included:

  • Genotype controls:

    • Wild-type Arabidopsis (Col-0) as a positive control

    • Known stress-responsive mutants as reference controls

    • Multiple independent transgenic/mutant lines for At5g23160 to rule out position effects

  • Treatment controls:

    • No-stress condition (baseline)

    • Graduated stress levels to determine dose-responsiveness

    • Different types of stresses to determine specificity (e.g., biotic vs. abiotic stressors)

    • Time-course experiments to capture dynamic responses

  • Experimental validation controls:

    • Technical replicates to ensure measurement precision

    • Biological replicates to account for natural variation

    • Randomized experimental design to minimize systematic errors

    • Standardized growth and treatment conditions

  • Molecular controls:

    • Housekeeping genes for normalization in expression studies

    • Empty vector controls for protein interaction studies

    • Complementation studies to confirm phenotype causality

The experimental design should systematically account for variability and include appropriate measurement of outcomes, as highlighted in the rubric for experimental design (RED) .

How might At5g23160 be involved in G-protein signaling pathways in Arabidopsis?

While direct evidence linking At5g23160 to G-protein signaling has not been explicitly established in the provided search results, several features of the protein suggest potential involvement:

  • Structural characteristics: The amino acid sequence of At5g23160 contains regions that share similarities with components of signaling pathways, including potential transmembrane domains and signaling motifs .

  • Heterotrimeric G-protein context: Arabidopsis contains known G-protein components, including α, β, and γ subunits. The heterotrimeric G proteins in plants regulate several signal-transduction pathways, though they appear to be used to a lesser extent than in animals .

  • Research approach: To investigate potential G-protein connections, researchers should consider:

    • Protein interaction studies with known G-protein components (similar to the yeast two-hybrid approach used to identify AGG1)

    • Phenotypic comparisons between At5g23160 mutants and known G-protein mutants

    • Signaling assays to determine if At5g23160 affects G-protein-mediated responses

  • Functional assessment: Testing for altered responses to hormones and environmental stimuli that typically involve G-protein signaling in At5g23160 mutants could reveal functional connections .

To conclusively establish a role in G-protein signaling, biochemical evidence of direct interaction with G-protein components and genetic evidence of functional relevance in the same pathways would be required.

What methodologies are most effective for characterizing protein-protein interactions involving At5g23160?

To characterize protein-protein interactions involving At5g23160, researchers should consider a multi-tiered approach:

  • Initial screening methods:

    • Yeast two-hybrid (Y2H): This system has proven effective for plant G-proteins, as demonstrated in the isolation of the Arabidopsis γ-subunit using a tobacco G-β-subunit as bait. For At5g23160, both N-terminal and C-terminal fusions should be tested due to potential functional domains .

    • Split-ubiquitin system: Particularly useful if At5g23160 is membrane-associated, as suggested by its sequence .

  • Validation methods:

    • Co-immunoprecipitation (Co-IP): Using the His-tagged recombinant protein as bait to pull down interacting partners from plant lysates, followed by mass spectrometry identification .

    • Bimolecular Fluorescence Complementation (BiFC): To visualize interactions in planta and determine subcellular localization of interaction complexes.

    • Surface Plasmon Resonance (SPR) or Isothermal Titration Calorimetry (ITC): To determine binding kinetics and affinity constants for identified interactions.

  • Functional validation:

    • Co-expression studies: Examining if At5g23160 and potential interactors are co-expressed under specific conditions.

    • Genetic interaction studies: Analyzing phenotypes of single and double mutants to identify genetic relationships.

  • Data presentation and analysis:

    • Results should be presented in well-organized tables showing interaction partners, detection methods, and interaction strengths .

    • Interaction networks should be visualized using appropriate charts and graphs to enhance readability and interpretation .

This comprehensive approach provides multiple lines of evidence for interactions and reduces the likelihood of false positives.

How does environmental acclimation affect the function of uncharacterized proteins like At5g23160 in plant defense responses?

Environmental acclimation can fundamentally alter the functional role of proteins in plant defense responses, as demonstrated by research on other Arabidopsis genes. While specific data on At5g23160 is limited, insights from related research suggest:

  • Functional conversion: Some Arabidopsis genes, such as AT5G06230, AT3G12910, and AT5G37840, act as resistance factors under temperate conditions but become susceptibility factors under Mediterranean acclimation (characterized by high daily thermal amplitude) . Uncharacterized proteins like At5g23160 might similarly display condition-dependent functional shifts.

  • Experimental approach for investigating acclimation effects:

    • Comparative phenotyping: Test At5g23160 mutants after different acclimation regimes (e.g., temperate vs. Mediterranean conditions).

    • Transcriptional analysis: Analyze expression patterns of At5g23160 and its potential target genes under different acclimation conditions followed by pathogen challenge.

    • Protein interaction profiling: Determine if protein interaction networks change following different acclimation treatments .

  • Potential molecular mechanisms:

    • Post-translational modifications induced by environmental conditions

    • Altered subcellular localization under different conditions

    • Changes in interacting partners or protein complex formation

    • Differential expression of regulatory elements

A comprehensive experimental design for studying such effects would include different accessions (Col-0, Rld-2, Sha) as references and multiple mutant lines to establish condition-dependent functions .

What are the challenges in expressing and purifying At5g23160 for structural studies, and how can they be overcome?

Expressing and purifying uncharacterized proteins like At5g23160 for structural studies presents several challenges:

  • Protein solubility issues:

    • Challenge: The amino acid sequence of At5g23160 suggests potential membrane-spanning regions, which often lead to solubility problems during expression .

    • Solution: Test multiple expression conditions (temperature, induction time, inducer concentration); use solubility-enhancing fusion partners (SUMO, MBP, or TRX tags); optimize buffer conditions during purification; employ detergents for membrane-associated regions.

  • Protein stability concerns:

    • Challenge: Maintaining protein stability during purification and storage.

    • Solution: Include protease inhibitors during purification; optimize buffer components (pH, salt concentration, reducing agents); add stabilizing agents like glycerol (5-50%) for storage; aliquot and avoid repeated freeze-thaw cycles .

  • Obtaining sufficient quantities for structural studies:

    • Challenge: Structural techniques like X-ray crystallography require milligram quantities of pure protein.

    • Solution: Scale up production; optimize codon usage for expression host; test alternative expression systems (insect cells, yeast); consider cell-free expression systems for problematic proteins.

  • Protein purity requirements:

    • Challenge: Structural studies require >95% purity.

    • Solution: Implement multi-step purification strategies beyond initial His-tag affinity purification, such as ion exchange, size exclusion chromatography, and potentially tag removal with specific proteases .

  • Crystallization obstacles:

    • Challenge: Obtaining diffraction-quality crystals.

    • Solution: Screen numerous crystallization conditions; consider surface entropy reduction mutations; use crystallization chaperones; explore alternative structure determination methods like cryo-EM for larger complexes or NMR for smaller domains.

Successful structural characterization could provide valuable insights into At5g23160's function and potential interaction interfaces.

How can contradictory results in At5g23160 functional studies be reconciled and interpreted?

When faced with contradictory results in functional studies of uncharacterized proteins like At5g23160, researchers should implement the following methodological approaches:

  • Context-dependent function analysis:

    • Approach: Systematically vary experimental conditions (temperature, light, humidity, stress treatments) to determine if the protein has context-dependent functions.

    • Example framework: Some Arabidopsis proteins function as resistance factors under temperate conditions but as susceptibility factors under Mediterranean acclimation .

  • Technical validation:

    • Approach: Cross-validate results using complementary techniques and ensure methodological rigor.

    • Implementation: Use multiple alleles or genetic constructs; confirm results across different genetic backgrounds; verify protein expression and localization in each experimental system .

  • Temporal and spatial resolution:

    • Approach: Analyze function with higher temporal and spatial resolution.

    • Techniques: Use inducible expression systems; tissue-specific promoters; time-course experiments; single-cell or tissue-specific analyses.

  • Data presentation and analysis:

    • Approach: Ensure comprehensive data reporting and appropriate statistical analysis.

    • Best practices: Present data in well-designed tables and figures that clearly show both expected and unexpected results; use appropriate statistical tests; consider multivariable analysis to identify interacting factors .

  • Systematic documentation of variables:

    • Approach: Thoroughly document all experimental variables that might affect outcomes.

    • Important factors: Growth conditions; developmental stage; time of day; sample handling procedures; reagent sources and lot numbers .

  • Collaborative verification:

    • Approach: Engage multiple laboratories to independently verify key findings.

    • Implementation: Standardize protocols across labs; blind sample analysis when possible; pool data for meta-analysis.

This systematic approach can reveal whether contradictions reflect genuine biological complexity or methodological issues.

What emerging technologies could accelerate the functional characterization of uncharacterized proteins like At5g23160?

Several emerging technologies show promise for accelerating the functional characterization of uncharacterized proteins like At5g23160:

  • CRISPR-based technologies:

    • CRISPR activation/interference: For precise modulation of gene expression without permanent genetic changes

    • Base editing and prime editing: For creating specific amino acid substitutions to test functional hypotheses

    • CRISPR screens: For high-throughput phenotypic analysis under various conditions

  • Advanced imaging techniques:

    • Super-resolution microscopy: For detailed subcellular localization

    • Live-cell imaging with optogenetic tools: For studying dynamic protein interactions and activities

    • Correlative light and electron microscopy (CLEM): For connecting protein localization with ultrastructural context

  • Proteomics approaches:

    • Proximity labeling (BioID, TurboID): For identifying neighboring proteins in native cellular contexts

    • Thermal proteome profiling: For discovering ligands and activity-based protein profiling

    • Crosslinking mass spectrometry: For mapping protein interaction interfaces

  • High-throughput phenotyping:

    • Automated plant phenotyping platforms: For comprehensive phenotypic analysis under various conditions

    • Single-cell transcriptomics: For cell-type-specific functional insights

    • Metabolomics integration: For connecting protein function to metabolic outcomes

  • Computational and AI-driven approaches:

    • AlphaFold2 and related tools: For accurate protein structure prediction to inform functional hypotheses

    • Machine learning models: For predicting protein function from sequence, expression, and interaction data

    • Network biology approaches: For placing uncharacterized proteins in functional contexts

These technologies, particularly when used in combination, could dramatically accelerate the functional characterization of At5g23160 and similar uncharacterized proteins in Arabidopsis.

How might comparative studies across different plant species inform our understanding of At5g23160 function?

Comparative studies across different plant species can provide valuable insights into the function of uncharacterized proteins like At5g23160:

  • Evolutionary conservation analysis:

    • Approach: Identify homologs across diverse plant species and analyze sequence conservation patterns.

    • Implementation: Construct phylogenetic trees to trace evolutionary history; identify conserved domains and sequence motifs; analyze selection pressures on different protein regions.

    • Interpretation: Highly conserved regions often indicate functional importance; lineage-specific adaptations may suggest specialized functions.

  • Expression pattern comparison:

    • Approach: Compare expression patterns of At5g23160 homologs across species under various conditions.

    • Data sources: Public transcriptome databases; new targeted experiments in model species.

    • Analysis: Co-expression network analysis to identify conserved regulatory modules.

  • Functional complementation studies:

    • Approach: Test if homologs from other species can rescue Arabidopsis At5g23160 mutant phenotypes.

    • Design: Express homologs from diverse species (monocots, other dicots, basal plants) in Arabidopsis mutants.

    • Interpretation: Successful complementation suggests conserved function; partial complementation may reveal evolutionary specialization.

  • Comparative interactome analysis:

    • Approach: Compare protein interaction networks across species.

    • Techniques: Yeast two-hybrid or Co-IP studies with homologs from multiple species .

    • Analysis: Identify conserved and species-specific interaction partners.

  • Cross-species functional genomics:

    • Approach: Generate and phenotype mutants of At5g23160 homologs in other model plants.

    • Target species: Rice, tomato, Medicago, Brachypodium, moss (Physcomitrella).

    • Comparative phenotyping: Under standardized conditions to reveal conserved and divergent functions.

This comparative approach could reveal whether At5g23160's function is plant-universal or specialized to Arabidopsis or Brassicaceae, providing evolutionary context for its role.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.