Recombinant Arabidopsis thaliana Uncharacterized protein At5g65660 (At5g65660)

Shipped with Ice Packs
In Stock

Description

General Information

At5g65660 is a protein that is present in Arabidopsis thaliana . The full-length recombinant form of this protein consists of 136 amino acids and is often produced in E. coli with a His-tag for research purposes . The Arabidopsis thaliana gene coding for At5g65660 is investigated to understand the molecular mechanisms underlying various biological processes, including responses to environmental stimuli such as humidity and drought, as well as its involvement in metabolic pathways .

Functional Annotation

The functional annotation of At5g65660 is still under investigation, but some information is available based on computational analysis and experimental studies .

3.1. Protein Domains
At5g65660 possesses a domain of unknown function. One InterPro ID associated with this protein is IPR037699, which is described as "Uncharacterized protein At5g65660-like" .

3.2. GO Functional Annotation
Gene Ontology (GO) terms provide a standardized way to describe the functions of genes and proteins. At5g65660 has several GO annotations, which describe its potential functions in the cell .

3.3. KEGG Pathway Annotation
The Kyoto Encyclopedia of Genes and Genomes (KEGG) pathway annotations provide information on the metabolic pathways in which At5g65660 might be involved .

Interactions and Pathways

Research suggests that At5g65660 participates in various pathways and interacts with different proteins and molecules within the cell . These interactions are often detected through methods like yeast two-hybrid assays, co-immunoprecipitation (co-IP), and pull-down assays. Further information on specific interacting proteins and their functional relationships can be found at specialized databases such as Creative BioMart .

Expression and Regulation

The expression of At5g65660 can be influenced by various factors, including environmental conditions and developmental stages . For example, RNA sequencing (RNA-seq) data has shown that the expression of At5g65660 is altered in response to mild drought stress . Additionally, studies on other Arabidopsis thaliana proteins, such as HYL1, have shown that their expression and processing are intricately regulated, underscoring the complexity of gene regulation in plants .

Role in Stress Response

Plants respond to fluctuating environmental conditions, including humidity and drought . Studies have indicated that At5g65660 may play a role in these stress responses. For instance, research on Arabidopsis has shown that plants respond to high humidity through calcium signaling pathways, and the expression of certain genes, like CYP707A3, is induced by high humidity . Similarly, the expression of At5g65660 is affected by drought stress, suggesting its involvement in drought response mechanisms .

Homologs Across Species

Homologs of At5g65660 may exist in other plant species, indicating a conserved function across different species . These homologs are identified through comparative genomics, which helps to predict the function of At5g65660 based on the known functions of its counterparts in other plants.

Tables of Data

Table 1: Protein Information for At5G65660

FeatureDescription
Full NameArabidopsis Thaliana Uncharacterized Protein At5G65660
Source (Host)E. coli
SpeciesArabidopsis thaliana
TagHis-Tagged
Protein LengthFull Length (1-136)

Table 2: Examples of Functional Categories Associated with At5G65660

CategoryDescription
Protein DomainUncharacterized protein At5g65660-like
GO Term(Specific GO terms would be listed here when known)
KEGG Pathway(Specific KEGG pathways would be listed here)

Future Research Directions

Further research is needed to fully elucidate the function of At5g65660. Future studies could focus on:

  1. Determining the precise structure of At5g65660 using techniques such as X-ray crystallography or cryo-electron microscopy.

  2. Investigating the biochemical activity of At5g65660 through enzymatic assays and binding studies.

  3. Identifying interacting partners of At5g65660 using proteomics approaches.

  4. Analyzing the phenotypic effects of At5g65660 mutants under various stress conditions.

  5. Exploring the evolutionary conservation of At5g65660 in other plant species.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
At5g65660; K21L13.18; Uncharacterized protein At5g65660
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At5g65660
Target Protein Sequence
MENTQDFSPPHMDASRPSLGFPLGTALLLIIIFSLSGIFSCCYHWDKHRSLRRSLANGRP SADIESNPYKPKPPFPEMKKPQNLSVPVLMPGDNTPKFIALPCPCAPPRPEKLTVDVQTP PQSPPVKPARFPVPLY
Uniprot No.

Target Background

Database Links

KEGG: ath:AT5G65660

STRING: 3702.AT5G65660.1

UniGene: At.28896

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What expression systems are available for recombinant production of At5g65660?

The recombinant At5g65660 protein has been successfully expressed in E. coli expression systems with an N-terminal His-tag . The expression methodology typically involves:

  • Gene synthesis or PCR amplification of the At5g65660 coding sequence

  • Cloning into an appropriate expression vector (typically with T7 promoter)

  • Transformation into an E. coli expression strain (BL21(DE3) or similar)

  • Induction with IPTG followed by purification via immobilized metal affinity chromatography

For optimal protein yield, researchers should consider testing different E. coli strains (BL21, Rosetta, Arctic Express) and induction conditions (temperature, IPTG concentration, induction time). While E. coli is the predominant system, alternative expression platforms like yeast or insect cells might be explored for proteins requiring post-translational modifications.

What is known about the tissue-specific expression pattern of At5g65660?

To determine the expression pattern experimentally, researchers can employ:

  • qRT-PCR analysis across multiple tissues and developmental stages

  • RNA in situ hybridization for spatial localization

  • Promoter-reporter fusion constructs (e.g., At5g65660 promoter driving GFP expression)

When isolating RNA for expression analysis, the TRIzol method followed by DNase treatment (as described in search result ) is recommended:

  • Isolate total RNA using TRIzol Reagent

  • Measure RNA concentration using NanoDrop

  • Remove genomic DNA using RQ1 RNase-free DNase

  • Confirm DNA removal by PCR

  • Check RNA integrity by agarose gel electrophoresis

  • Perform reverse transcription with oligo(dT) primers

What are the recommended storage conditions for recombinant At5g65660 protein?

For optimal stability and activity of recombinant At5g65660 protein, the following storage conditions are recommended:

  • Long-term storage: Store lyophilized powder or aliquoted protein at -20°C/-80°C

  • Storage buffer: Tris-based buffer with 6-50% glycerol, pH 8.0

  • Working aliquots: Store at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles, which can cause protein degradation and aggregation

For reconstitution of lyophilized protein:

  • Centrifuge the vial briefly before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50%

  • Aliquot for long-term storage at -20°C/-80°C

What methodologies are recommended for studying potential protein-protein interactions of At5g65660?

Given the uncharacterized nature of At5g65660, identifying its interaction partners could provide crucial functional insights. Several complementary approaches are recommended:

Yeast Two-Hybrid (Y2H) Screening:

  • Clone At5g65660 into a bait vector (e.g., pGBKT7)

  • Screen against an Arabidopsis cDNA library in a prey vector

  • Validate positive interactions by targeted Y2H and alternative methods

Co-Immunoprecipitation (Co-IP):
Similar to the approach used in the study by Mester et al. (search result ):

  • Express tagged At5g65660 in Arabidopsis or a heterologous system

  • Prepare protein extracts using a protocol for membrane proteins

  • Immunoprecipitate using tag-specific antibodies

  • Analyze co-precipitated proteins by Western blot or mass spectrometry

Proximity-Based Labeling (BioID or TurboID):

  • Generate fusion constructs of At5g65660 with a proximity labeling enzyme

  • Express in Arabidopsis cells

  • Purify biotinylated proteins and identify by mass spectrometry

For validation of membrane protein interactions, techniques like Förster Resonance Energy Transfer (FRET) or Bimolecular Fluorescence Complementation (BiFC) may be particularly useful.

Creating precise At5g65660 knockout or modified lines requires careful CRISPR-Cas9 design and validation:

gRNA Design Strategy:

  • Select target sites in early exons of At5g65660

  • Check for potential off-target sites in the Arabidopsis genome

  • Design gRNAs with optimal GC content (40-60%)

  • Consider using paired nickases for higher specificity

Vector Construction and Transformation:

  • Clone gRNAs into a plant-compatible CRISPR-Cas9 vector (e.g., pHEE401E)

  • Transform into Agrobacterium tumefaciens

  • Transform Arabidopsis using floral dip method

  • Select transformants on appropriate selection medium

Mutation Verification:

  • Extract genomic DNA using a method like the DNeasy Plant Mini Kit mentioned in search result

  • PCR amplify the target region

  • Sequence the PCR products to identify mutations

  • Confirm homozygous mutations in T2 generation

Phenotypic Analysis:
Given that At5g65660 appears in studies related to trichome development and nitrogen metabolism , focus phenotypic analysis on:

This approach is similar to the methods used for gene deletion in Rhodobacter capsulatus described in search result , adapted for the Arabidopsis model system.

What are the recommended approaches for analyzing potential post-translational modifications of At5g65660?

As an uncharacterized protein, At5g65660 may undergo post-translational modifications (PTMs) that are crucial for its function. A systematic approach to PTM analysis would include:

Mass Spectrometry-Based Identification:

  • Express and purify recombinant At5g65660

  • Perform protease digestion (e.g., trypsin)

  • Analyze peptides by LC-MS/MS

  • Search for specific PTMs (phosphorylation, glycosylation, etc.)

For phosphorylation analysis specifically:

  • Enrich phosphopeptides using TiO2 or IMAC columns

  • Analyze by LC-MS/MS with neutral loss scanning

  • Validate using phospho-specific antibodies if available

In vivo PTM Analysis:

  • Express tagged At5g65660 in Arabidopsis

  • Immunoprecipitate the protein

  • Analyze by Western blot using PTM-specific antibodies

  • Confirm by mass spectrometry

This approach is similar to the protocol for protein extraction and mass spectrometry described in search result :

  • Use urea/thiourea lysis buffer with protease inhibitors

  • Reduce with dithiothreitol and alkylate with iodoacetamide

  • Digest with Lys-C followed by trypsin

  • Desalt using reverse-phase micro-columns

  • Analyze by LC-MS/MS

How can differential expression of At5g65660 be analyzed under various stress conditions?

Understanding how At5g65660 responds to different stresses may provide functional insights:

Experimental Design:

  • Expose Arabidopsis plants to various stresses:

    • Abiotic stresses (drought, salt, heat, cold)

    • Biotic stresses (pathogens, herbivory)

    • Nutrient stresses (nitrogen, phosphorus limitation)

    • Oxidative stress (H₂O₂, paraquat treatment)

  • Collect tissue samples at multiple time points

Expression Analysis Methods:

  • qRT-PCR following protocols in search result

  • RNA-seq for genome-wide expression changes

  • Protein-level changes via Western blotting

ROS-Related Analysis:
Since At5g65660 may be involved in stress responses, measuring ROS production as described in search result would be valuable:

  • Use DCF-fluorescence to measure light-induced ROS generation

  • Perform PAM measurements to assess photosynthetic performance

  • Use indicator dyes to visualize ROS production in leaves

Data Integration:
Apply machine learning approaches similar to those described in search result to:

  • Identify optimal experimental conditions (OPEX method)

  • Predict gene expression patterns

  • Design follow-up experiments with maximum information gain

What are the best methods for determining the subcellular localization of At5g65660?

Given the predicted transmembrane domain in At5g65660, determining its precise subcellular localization is crucial:

Fluorescent Protein Fusion Approaches:

  • Generate C-terminal and N-terminal GFP/YFP fusions of At5g65660

  • Express in Arabidopsis protoplasts or stable transgenic plants

  • Visualize using confocal laser scanning microscopy as mentioned in search result

  • Co-localize with known organelle markers

Immunolocalization:

  • Generate antibodies against At5g65660 or use antibodies against the tag

  • Perform immunofluorescence on fixed Arabidopsis tissues

  • Co-stain with organelle markers

  • Image using confocal microscopy

Biochemical Fractionation:

  • Isolate subcellular fractions (membrane, cytosol, organelles)

  • Perform Western blot analysis to detect At5g65660

  • Compare with known marker proteins for different compartments

The microscopy techniques outlined in search result would be particularly relevant:

  • Wet-mounting seedlings in culture media for live cell imaging

  • Using both fluorescence and confocal laser scanning microscopy

  • Performing time-lapse measurements to track protein dynamics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.