Recombinant Arabidopsis thaliana Uncharacterized protein PAM68-like (At5g52780)

What is the Arabidopsis thaliana PAM68-like protein (At5g52780)?

The At5g52780 gene encodes an uncharacterized protein PAM68-like in Arabidopsis thaliana. This protein consists of 168 amino acids and has the UniProt ID Q9LTD9. The full amino acid sequence is: MRALLCSHRLLPLSSLSRTTVKTKSHNPKTLYPNNKPRWESKLHAGPKGFQSSRTSEKPGRPDPDPEDDPPIPQEVFERMMGRIVVSVGTPLGLGVAILKVLEVLKDRNVWDVPLWVPYLTTLVTFGSSALGIAYGSLSTNLDPAKTNSLFGLKEAKENWVEMWKEDQ . While classified as "uncharacterized," it belongs to the PAM68 family of proteins, which have been implicated in photosynthetic processes in plants.

How is recombinant At5g52780 protein typically produced for research purposes?

The recombinant Full Length Arabidopsis thaliana Uncharacterized protein PAM68-like (At5g52780) is typically produced using E. coli expression systems. The protein is expressed with an N-terminal histidine tag to facilitate purification. The full-length protein (amino acids 1-168) is expressed and then purified using affinity chromatography methods that exploit the His-tag. After purification, the protein is typically lyophilized for stable storage and distribution .

What are the optimal storage conditions for recombinant At5g52780 protein?

For optimal stability, the lyophilized recombinant At5g52780 protein should be stored at -20°C/-80°C upon receipt. For working with the protein, it should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To prevent protein degradation during storage, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being typical) and then aliquot for long-term storage at -20°C/-80°C. Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week .

What photosynthetic parameters should be measured when studying potential roles of At5g52780 in photosynthesis?

When investigating the potential roles of At5g52780 in photosynthesis, researchers should consider measuring several key photosynthetic parameters:

• Maximum quantum yield (Fv/Fm): Measure the fluorescence of dark-adapted leaves (F0) before exposing them to pulses of red light to determine maximum fluorescence (Fm) and calculate Fv/Fm (where Fv is Fm - F0).

• Effective quantum yield of PSII (φII): Calculate using the equation φII = (Fm' - Fs)/Fm', where Fs is steady-state fluorescence and Fm' is measured after a red light pulse.

• Photochemical quenching (qP): Calculate using qP = (Fm' - Fs)/(Fm' - F0).

• Non-photochemical quenching (NPQ): Calculate using qN = (Fm - Fm')/(Fm - F0).

These measurements should be performed under increasing light intensities (0-2000 μmol m-2 s-1) at regular intervals to assess light dependency of these parameters .

How can protein expression levels of At5g52780 be reliably detected and quantified in plant tissues?

For reliable detection and quantification of At5g52780 protein expression in plant tissues:

• Sample preparation: Grind leaf tissue in 2× SDS loading buffer to extract total protein.

• Protein separation: Fractionate proteins by SDS-PAGE (12% gels recommended).

• Protein transfer: Transfer separated proteins to polyvinylidene difluoride (PVDF) membranes.

• Blocking: Block membranes with TBST (10mM Tris pH 8.0, 150mM NaCl, and 0.1% Tween 20) supplemented with 5% (w/v) milk powder.

• Antibody incubation: Since specific antibodies for At5g52780 may not be commercially available, generate custom antibodies against the recombinant protein or use antibodies against the His-tag if working with the recombinant version.

• Detection: Apply appropriate secondary antibody and detect signals using enhanced chemiluminescence (ECL) and an imaging system.

• Quantification: Quantify protein levels using appropriate software (e.g., Bioprofile software) .

For comparative analysis, include appropriate controls such as housekeeping proteins or other photosynthetic subunits (like PsaD or cpATPase β-subunit).

How can multi-omics approaches be applied to study the regulatory mechanisms of At5g52780?

Multi-omics approaches can provide comprehensive insights into the regulatory mechanisms of At5g52780 through:

• RNA-seq analysis: Identify transcriptional changes in At5g52780 under different conditions or in various mutant backgrounds. Compare expression patterns with other genes to identify co-regulation networks.

• ATAC-seq analysis: Map chromatin accessibility of the At5g52780 promoter region to identify potential transcription factor binding sites. This involves:

  • Peak annotation using packages like ChIPseeker

  • Identifying peaks located in the promoter region of At5g52780

  • Correlating these peaks with chromatin accessibility under different conditions

• ChIP-seq analysis: Identify transcription factors that physically bind to the At5g52780 promoter region. This requires:

  • Downloading transcription factor lists from databases like Cistrome

  • Performing correlation analysis between transcription factor expression and ATAC-seq peak accessibility

  • Confirming physical binding through ChIP-seq data verification

• Integration analysis: Combine data from these different approaches to build a comprehensive regulatory model for At5g52780 expression and function.

What approaches can be used to characterize the function of At5g52780 in Arabidopsis thaliana?

To characterize the function of this uncharacterized protein, multiple complementary approaches should be employed:

• Genetic approaches:

  • Generate knockout/knockdown lines using T-DNA insertion or CRISPR-Cas9

  • Create overexpression lines

  • Develop complementation lines for functional validation

  • Construct lines with tagged versions of the protein for localization studies

• Physiological characterization:

  • Assess photosynthetic parameters (as described in Q2.1)

  • Measure growth rates under different light conditions

  • Evaluate stress responses (particularly to light stress)

  • Analyze senescence patterns in mutant vs. wild-type plants

• Biochemical approaches:

  • Determine protein localization within the cell using subcellular fractionation

  • Identify interaction partners through co-immunoprecipitation or yeast two-hybrid assays

  • Assess post-translational modifications

  • Characterize protein dynamics during development or stress responses

• Structural biology:

  • Determine protein structure through X-ray crystallography or cryo-EM

  • Perform in silico modeling based on the amino acid sequence

  • Identify functional domains through targeted mutagenesis

How can researchers address protein solubility issues when working with recombinant At5g52780?

When encountering solubility issues with recombinant At5g52780:

• Optimization of expression conditions:

  • Test different E. coli strains (BL21, Rosetta, etc.)

  • Vary induction temperatures (16°C, 25°C, 37°C)

  • Adjust IPTG concentrations (0.1-1.0 mM)

  • Explore auto-induction media alternatives

• Buffer optimization for reconstitution:

  • Start with the recommended Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Test different pH conditions (pH 6.0-9.0)

  • Add solubility enhancers (glycerol, mild detergents, arginine)

  • Consider adding reducing agents if the protein contains multiple cysteines

• Protein refolding strategies:

  • If protein forms inclusion bodies, develop refolding protocols

  • Use step-wise dialysis to gradually remove denaturants

  • Employ molecular chaperones during refolding

• Alternative tag systems:

  • Test different fusion tags (MBP, GST, SUMO) that may enhance solubility

  • Consider dual tagging approaches

  • Evaluate tag position effects (N-terminal vs. C-terminal)

What statistical approaches are recommended for analyzing differential expression of At5g52780 in multi-omics datasets?

For robust statistical analysis of At5g52780 differential expression in multi-omics datasets:

• RNA-seq data analysis:

  • Use DESeq2 or edgeR for differential expression analysis

  • Apply appropriate normalization methods

  • Set significance thresholds (typically adjusted p-value < 0.05 and log2 fold change > 1)

  • Perform power analysis to ensure adequate sample size

• ATAC-seq data analysis:

  • Identify reproducible peaks in the At5g52780 promoter region

  • Use packages like ChIPseeker for peak annotation

  • Perform correlation analysis between peak accessibility and gene expression

• Integration with phenotypic data:

  • Use reduced-Cox regression models to assess prognostic value

  • Perform Pearson correlation analysis between gene expression and chromatin accessibility

  • Apply multiple testing corrections for all statistical tests

• Validation strategies:

  • Confirm key findings with qPCR

  • Validate results across multiple databases to minimize bias

  • Use multiple algorithms (like EPIC, XCELL, TIMER, and MCP-counter) to confirm significant correlations

How can researchers effectively measure reactive oxygen species (ROS) production in relation to At5g52780 function?

To effectively measure ROS production in the context of At5g52780 function:

• Protoplast-based ROS measurements:

  • Isolate protoplasts from plant tissues

  • Wash protoplasts with appropriate buffer

  • Incubate with H2DCFDA (5 μM) in the dark for 30 minutes

  • Wash twice and resuspend in MMg solution (0.4M mannitol, 15mM MgCl2, 4mM MES pH 5.7)

  • Monitor DCF fluorescence using fluorescence microscopy

  • Define the first image taken immediately after illumination as the 'dark' state

  • Measure fluorescence intensity over time (typically 2 minutes)

• Whole-leaf ROS measurements:

  • Employ DAB (3,3'-diaminobenzidine) staining for H2O2 detection

  • Use NBT (nitroblue tetrazolium) for superoxide detection

  • Quantify staining using image analysis software

• Biochemical ROS assays:

  • Measure H2O2 levels using Amplex Red assays

  • Assess lipid peroxidation through MDA (malondialdehyde) content

  • Evaluate antioxidant enzyme activities (SOD, catalase, peroxidases)

• Data analysis considerations:

  • Track at least 3 chloroplasts in a minimum of 10 protoplasts

  • Calculate mean fluorescence intensity at 30 seconds after illumination

  • Use the linear portion of the curve for consistent measurements

  • Compare wild-type with At5g52780 mutant lines under identical conditions

What are promising research avenues for elucidating the relationship between At5g52780 and photosystem assembly?

Based on the PAM68-like classification, promising research directions include:

• Protein interaction network analysis:

  • Perform co-immunoprecipitation studies with tagged At5g52780

  • Map interactions with photosystem components

  • Use proximity labeling approaches (BioID, APEX) to identify transient interactions

  • Compare interaction networks under different light conditions

• Temporal dynamics during photosystem assembly:

  • Track At5g52780 expression and localization during chloroplast development

  • Investigate its role during recovery from photoinhibition

  • Examine responses to light quality changes (red vs. blue light)

  • Study protein accumulation patterns in greening experiments

• Structural contributions to photosystem functionality:

  • Generate domain-specific mutations to identify functional regions

  • Perform complementation studies with chimeric proteins

  • Assess conservation across species with varying photosynthetic adaptations

  • Develop structural models of At5g52780 interaction with photosystem components

• Metabolic impact assessment:

  • Perform metabolomics analyses of wild-type vs. mutant plants

  • Focus on photosynthetic intermediates and energy metabolites

  • Correlate changes with photosynthetic efficiency measurements

  • Integrate with transcriptomic data for pathway analysis

How might epigenetic regulation influence At5g52780 expression under different environmental conditions?

To investigate epigenetic regulation of At5g52780:

• Chromatin accessibility mapping:

  • Perform ATAC-seq under various environmental conditions (high light, drought, temperature)

  • Map open chromatin regions in the At5g52780 promoter

  • Identify condition-specific changes in accessibility

• DNA methylation analysis:

  • Employ bisulfite sequencing to map methylation patterns

  • Compare methylation status under different environmental conditions

  • Correlate methylation levels with expression changes

  • Generate demethylation mutants to assess impact on At5g52780 expression

• Histone modification profiling:

  • Perform ChIP-seq for various histone marks (H3K4me3, H3K27me3, H3K9ac)

  • Map modifications along the At5g52780 locus

  • Track changes during development and stress responses

  • Use histone modification inhibitors to verify functional relationships

• Transcription factor binding dynamics:

  • Identify transcription factors correlated with At5g52780 expression

  • Confirm physical binding through ChIP-seq

  • Perform functional validation through overexpression/knockdown studies

  • Develop a comprehensive model of transcriptional regulation

What are the key sequence and structural features of the At5g52780 protein?

Table 1: Key Features of At5g52780 Protein

What experimental conditions should be optimized when working with recombinant At5g52780 protein?

Table 2: Recommended Experimental Conditions for Recombinant At5g52780