Recombinant Arabidopsis thaliana UPF0136 membrane protein At2g26240 (At2g26240)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your own protocols.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag preference, please inform us, and we will prioritize its implementation.
Synonyms
FAX7; At2g26240; T1D16.12; Protein FATTY ACID EXPORT 7; At-FAX7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
FAX7
Target Protein Sequence
MDSSLSQKFTLAYASLLGVGGLMGYLKRGSKISLVAGGGSAALFYYVYTELPGNPVLASS IGIVGSAALTGMMGSRYLRTRKVVPAGLVSVVSLVMTGAYLHGLIRSS
Uniprot No.

Target Background

Function
May be involved in the export of free fatty acids.
Database Links

KEGG: ath:AT2G26240

STRING: 3702.AT2G26240.1

UniGene: At.38923

Protein Families
TMEM14 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the function of the At2g26240 (FAX7) protein in Arabidopsis thaliana?

The At2g26240 gene encodes the Protein FATTY ACID EXPORT 7 (FAX7), which belongs to a family of proteins involved in fatty acid export across chloroplast membranes. While specific research on FAX7 is limited in the provided sources, it is part of the fatty acid export (FAX) protein family that plays crucial roles in lipid transport processes in plant cells .

FAX proteins generally facilitate the transport of fatty acids across membrane barriers, contributing to lipid metabolism and membrane biogenesis in plants. This function is particularly important considering that membrane proteins like At2g26240 often participate in signaling pathways that may interact with plant hormones such as salicylic acid and auxin, which regulate plant growth and defense responses .

How does the recombinant form of At2g26240 differ from the native protein?

The recombinant form of At2g26240 is expressed in E. coli and includes an N-terminal His tag to facilitate purification and detection . This differs from the native protein in several ways:

FeatureNative At2g26240Recombinant At2g26240
Expression systemArabidopsis thalianaE. coli
TagsNoneN-terminal His tag
GlycosylationPossible native plant patternsAbsent or different in bacterial system
FoldingNative plant cellular environmentBacterial cellular environment
PurityPart of membrane complex>90% purity after purification

These differences must be considered when using the recombinant protein for research, as they may affect protein function, stability, and interactions compared to the native form.

What are the optimal storage conditions for recombinant At2g26240 protein to maintain stability?

For optimal stability of the recombinant At2g26240 protein, the following storage conditions are recommended:

  • Store the lyophilized powder at -20°C/-80°C upon receipt.

  • After reconstitution, add glycerol to a final concentration of 5-50% (50% is recommended).

  • Aliquot the protein solution to avoid repeated freeze-thaw cycles.

  • For short-term use, working aliquots can be stored at 4°C for up to one week.

  • For long-term storage, keep aliquots at -20°C/-80°C .

The protein is supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability during storage . Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity.

What experimental design considerations are important when studying At2g26240 function in Arabidopsis?

When designing experiments to study At2g26240 function in Arabidopsis, researchers should consider a systematic approach following established experimental design principles:

  • Define clear variables:

    • Independent variable: Manipulation of At2g26240 expression (knockout, overexpression)

    • Dependent variables: Phenotypic changes, lipid profiles, membrane composition

    • Control variables: Growth conditions, plant age, tissue type

  • Formulate testable hypotheses about At2g26240 function in fatty acid transport or membrane dynamics.

  • Consider appropriate controls:

    • Wild-type Arabidopsis plants

    • Plants expressing a non-functional version of the protein

    • Plants with altered expression of related FAX family proteins

  • Select appropriate methods for protein localization and functional assessment:

    • Fluorescent protein fusions for subcellular localization

    • Lipidomic analyses to measure fatty acid transport

    • Phenotypic assays under various stress conditions

  • Plan for confounding variables that might affect experimental outcomes, such as:

    • Redundancy within the FAX protein family

    • Environmental factors affecting lipid metabolism

    • Developmental stage-specific expression patterns

Since Arabidopsis thaliana has a genome size of approximately 135 Mb and extensive genomic resources are available, researchers can leverage these resources for comprehensive studies .

How can the recombinant At2g26240 protein be reconstituted for functional studies?

For functional studies, proper reconstitution of the recombinant At2g26240 protein is critical:

  • Centrifuge the vial briefly before opening to bring contents to the bottom.

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • For membrane protein studies, consider reconstitution into liposomes or nanodiscs to maintain the native membrane environment.

  • The addition of 5-50% glycerol (final concentration) is recommended for stability.

  • Aliquot and store at -20°C/-80°C for long-term use .

For functional assays, it's important to verify protein folding and membrane integration after reconstitution, as these factors can significantly impact the protein's activity in experimental systems.

How does At2g26240 (FAX7) interact with hormone signaling pathways in Arabidopsis?

While specific interactions between At2g26240 (FAX7) and hormone signaling pathways are not directly described in the provided sources, research on related membrane proteins in Arabidopsis provides insights into potential mechanisms:

Salicylic acid (SA) has been shown to affect membrane protein function and distribution. SA can bind to protein phosphatase 2A (PP2A) and inhibit its activity, which affects the phosphorylation of membrane proteins like PIN auxin transporters . This suggests that membrane proteins, potentially including FAX7, may be regulated by SA-dependent signaling pathways.

The interaction between membrane proteins and auxin transport is particularly relevant:

  • SA can interfere with auxin distribution at either the transport level or during local auxin biosynthesis.

  • SA-treated seedlings exhibit gravitropism defects compared to controls, indicating disruption of auxin-dependent processes.

  • SA binding to PP2A increases phosphorylation of PIN auxin transporters, decreasing auxin export activity .

Researchers investigating At2g26240 should consider these hormone-dependent regulatory mechanisms, particularly if FAX7 functions are modulated during stress responses when SA levels increase.

What techniques are most effective for studying the localization and topology of At2g26240 in membrane systems?

For comprehensive analysis of At2g26240 localization and topology in membrane systems, researchers should consider multiple complementary approaches:

  • Fluorescent protein fusion techniques:

    • C-terminal and N-terminal GFP fusions to determine protein orientation

    • Split-GFP assays to verify membrane insertion topology

    • FRET-based approaches to study protein-protein interactions within membranes

  • Biochemical membrane fractionation:

    • Differential centrifugation to isolate membrane fractions

    • Protease protection assays to determine exposed protein domains

    • Chemical crosslinking to identify neighboring proteins

  • Advanced microscopy methods:

    • Super-resolution microscopy for precise localization

    • FRAP (Fluorescence Recovery After Photobleaching) to study protein dynamics

    • Correlative light and electron microscopy for ultrastructural context

  • Mass spectrometry-based approaches:

    • Limited proteolysis combined with mass spectrometry to map membrane-embedded regions

    • Hydrogen-deuterium exchange mass spectrometry to identify solvent-accessible regions

    • Proximity labeling techniques to identify interacting partners

When using recombinant protein, it's essential to validate findings with native protein expression systems to ensure biological relevance of the observations.

How does At2g26240 function compare to other members of the FAX protein family in Arabidopsis?

The FAX protein family in Arabidopsis includes multiple members involved in fatty acid export and membrane dynamics. While the search results don't provide specific comparative information about all FAX family members, researchers should consider the following comparative analysis approach:

  • Sequence and structural comparison:

    • Perform multiple sequence alignment of all FAX proteins

    • Identify conserved domains and variable regions

    • Predict structural similarities and differences

  • Expression pattern analysis:

    • Compare tissue-specific expression profiles

    • Analyze developmental regulation patterns

    • Examine stress-responsive expression changes

  • Functional redundancy assessment:

    • Generate single and multiple FAX gene mutants

    • Perform complementation studies

    • Analyze fatty acid profiles in various mutant combinations

  • Localization studies:

    • Compare subcellular localization of different FAX proteins

    • Identify unique membrane compartments for each protein

    • Determine if co-localization occurs in specific tissues or conditions

Understanding the functional relationships between FAX family members is crucial for determining whether At2g26240 has unique functions or shares redundant roles with other family members.

What strategies are recommended for generating and confirming At2g26240 knockout or overexpression lines in Arabidopsis?

Creating reliable genetic resources for studying At2g26240 function requires careful methodological considerations:

For knockout lines:

  • CRISPR/Cas9-based gene editing:

    • Design sgRNAs targeting conserved regions of At2g26240

    • Screen for frameshift mutations that eliminate protein function

    • Confirm mutations by sequencing and absence of protein by Western blot

  • T-DNA insertion lines:

    • Screen available Arabidopsis T-DNA insertion collections

    • Confirm homozygosity through PCR genotyping

    • Verify loss of transcript by RT-PCR and protein by immunoblotting

For overexpression lines:

  • Construct design:

    • Clone At2g26240 under a strong constitutive promoter (e.g., 35S)

    • Consider adding epitope tags for detection

    • Include appropriate selection markers

  • Transformation and selection:

    • Use Agrobacterium-mediated transformation

    • Select transformants on appropriate antibiotic media

    • Screen for high expressors by RT-PCR and Western blot

Confirmation strategies:

  • Molecular validation:

    • Genotyping and expression analysis

    • Protein level verification by immunoblotting

  • Functional validation:

    • Phenotypic analysis under standard and stress conditions

    • Lipid profile analysis

    • Complementation tests with native gene

  • Localization studies:

    • Confirm expected protein localization in modified lines

    • Verify membrane integration in overexpression lines

Working with the Arabidopsis thaliana genome, which is approximately 135 Mb in size, provides advantages due to extensive genomic resources and well-established transformation protocols .

How can researchers integrate At2g26240 studies with broader plant hormone and defense signaling research?

Integrating At2g26240 research with plant hormone and defense signaling studies requires understanding potential connections between fatty acid metabolism and signaling pathways:

  • Experimental design for hormone interaction studies:

    • Expose At2g26240 mutant lines to different hormone treatments

    • Monitor changes in gene expression and protein levels of At2g26240 after hormone application

    • Analyze fatty acid profiles in response to pathogen infection or hormone treatments

  • Integration with SA signaling pathways:

    • Investigate potential connections to NPR1, NPR2, NPR3, and NPR4 pathways

    • Test whether At2g26240 expression changes during SA-induced defense responses

    • Examine if mutants in SA pathways affect At2g26240 function or localization

  • Connection to auxin responses:

    • Analyze if At2g26240 function affects auxin distribution or signaling

    • Test gravitropism responses in At2g26240 mutants

    • Investigate potential interactions with PIN proteins

  • Pathogen response studies:

    • Challenge At2g26240 mutants with pathogens to assess disease resistance

    • Examine if pathogen-associated molecular patterns (PAMPs) alter At2g26240 expression

    • Test whether At2g26240 plays a role in pattern-triggered immunity (PTI) or effector-triggered immunity (ETI)

  • Integration with transcription factor networks:

    • Investigate whether CBP60g, SARD1, or WRKY70 regulate At2g26240 expression

    • Analyze promoter elements in At2g26240 for transcription factor binding sites

This integrated approach would help position At2g26240 within the broader context of plant hormone signaling and defense responses.

What statistical approaches are most appropriate for analyzing phenotypic data from At2g26240 mutant studies?

When analyzing phenotypic data from At2g26240 mutant studies, researchers should employ appropriate statistical methods based on experimental design:

  • For comparing two groups (e.g., wild-type vs. knockout):

    • Student's t-test for normally distributed data

    • Mann-Whitney U test for non-normally distributed data

    • Calculate effect sizes to determine biological significance

  • For multiple group comparisons (e.g., wild-type, knockout, overexpressor, complementation lines):

    • One-way ANOVA followed by post-hoc tests (Tukey's HSD, Bonferroni)

    • Kruskal-Wallis test followed by Dunn's test for non-parametric data

  • For time-course or developmental studies:

    • Repeated measures ANOVA

    • Mixed-effects models to account for random and fixed effects

    • Survival analysis for time-to-event data

  • For complex experimental designs:

    • Factorial ANOVA to analyze multiple factors and their interactions

    • MANOVA for multiple dependent variables

    • Principal component analysis (PCA) to identify patterns in multivariate data

  • Power analysis considerations:

    • Determine appropriate sample sizes before experiments

    • Consider biological and technical replicates

    • Account for potential variability in phenotypic traits

The experimental design should include appropriate controls and sufficient replication to ensure statistical validity and reproducibility of results .

How can researchers effectively analyze and interpret proteomics data related to At2g26240 interactions?

Analysis of proteomics data for At2g26240 interactions requires specialized approaches for membrane proteins:

  • Sample preparation considerations:

    • Optimize membrane protein extraction methods

    • Consider crosslinking approaches for transient interactions

    • Use appropriate detergents for membrane protein solubilization

  • Mass spectrometry data analysis pipeline:

    • Apply appropriate search algorithms specifically optimized for membrane proteins

    • Use stringent filtering criteria to reduce false positives

    • Implement controls to identify non-specific binding partners

  • Network analysis approaches:

    • Construct protein-protein interaction networks

    • Perform Gene Ontology enrichment analysis

    • Identify functional clusters among interacting partners

  • Data visualization strategies:

    • Create interaction maps highlighting confidence scores

    • Use hierarchical clustering to identify functional groups

    • Implement dynamic visualization tools for complex datasets

  • Validation strategies:

    • Confirm key interactions through orthogonal methods (co-IP, FRET, BiFC)

    • Perform reciprocal pull-downs

    • Validate biological relevance through genetic approaches

  • Membrane protein-specific considerations:

    • Account for hydrophobicity bias in detection

    • Consider detergent effects on interaction stability

    • Evaluate potential artifacts from membrane microdomain disruption

Integration of proteomics data with other omics approaches, such as transcriptomics and metabolomics, can provide a more comprehensive understanding of At2g26240 function in cellular contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.