Recombinant Arabidopsis thaliana UPF0480 protein At4g32130 (At4g32130)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Arabidopsis thaliana UPF0480 protein At4g32130 (At4g32130) is a protein expressed in E. coli and fused to an N-terminal His tag . It is a protein derived from Arabidopsis thaliana, also known as mouse-ear cress. This protein is related to the ER membrane protein complex subunit 7 homolog and is also known as F10N7.60.

Basic Information

CategoryDescription
SynonymsAt4g32130; F10N7.60; ER membrane protein complex subunit 7 homolog
SpeciesArabidopsis thaliana (Mouse-ear cress)
Uniprot No.Q8VY97
KEGGath:AT4G32130
STRING3702.AT4G32130.1
UniGeneAvailable via database links
Purity>85% (SDS-PAGE)
Tag InfoDetermined during the manufacturing process
Protein LengthPartial
Buffer Before Lyoph.Tris/PBS-based buffer, 6% Trehalose

Production and Sourcing

Recombinant At4g32130 is produced in various expression systems, including E. coli, yeast, baculovirus, and mammalian cells. The protein is available in both liquid and lyophilized forms. For the liquid form, the typical shelf life is six months when stored at -20°C/-80°C. The lyophilized form has a shelf life of 12 months under the same storage conditions. Aliquoting is recommended to avoid repeated freeze-thaw cycles.

Related Research

  • TOR Signaling Pathway: The TOR (target of rapamycin) signaling pathway, which balances cell growth and survival, has been studied in Arabidopsis thaliana . A knockout mutation in TOR is embryo-lethal, and down-regulation of TOR via RNA interference arrests plant growth and induces autophagy, suggesting that TOR is a positive regulator of growth and development, and a negative regulator of autophagy in plants .

  • Telomere Length Control: Arabidopsis thaliana telomeric DNA-binding protein 1 (AtTBP1) is involved in telomere length control . Lack of AtTBP1 results in deregulation of telomere length, with mutant telomeres expanding steadily .

  • Drought Tolerance: Overexpression of Arabidopsis nucleolar GTP-binding 1 (NOG1) enhances drought tolerance without compromising grain yield .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted according to your requirements.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
At4g32130; F10N7.60; ER membrane protein complex subunit 7 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-202
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At4g32130
Target Protein Sequence
LPISSGSEDSYTITGRVRVPASTVIGHAAKFSNIKVILNGGQHVTFLRPDGYFTFHKVPA GTHLIEVYALGYFFSPVRVDVSARHRGKVQATLTETRRSLTELVLEPLRAEQYYEMREPF SVMSIVKSPMGLMVGFMVVVVFLMPKLMENIDPEEMKSAQEQMRSQGVPSLTSLLPASR
Uniprot No.

Target Background

Database Links

KEGG: ath:AT4G32130

STRING: 3702.AT4G32130.1

UniGene: At.31685

Protein Families
EMC7 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the UPF0480 protein At4g32130 and what are its key characteristics?

The UPF0480 protein At4g32130 (UniProt ID: Q8VY97) is a protein from Arabidopsis thaliana that spans amino acids 24-202 of the mature protein. It has several identified synonyms including F10N7.60 and "ER membrane protein complex subunit 7 homolog" . The protein belongs to the UPF0480 family, a group of uncharacterized proteins with conserved function across species. The full-length recombinant version is typically expressed with an N-terminal His tag to facilitate purification and detection in experimental applications .

How does At4g32130 relate to the broader context of Arabidopsis thaliana research?

Arabidopsis thaliana serves as a model organism in plant molecular biology and genetics research. The 1001 Epigenomes Project provides a comprehensive resource for understanding how epigenetic variation contributes to both molecular and phenotypic diversity in natural populations of this widely studied reference plant . At4g32130, as part of the Arabidopsis proteome, contributes to our understanding of plant cellular processes. While direct functions of At4g32130 are not extensively characterized in the search results, its study can be placed within the broader context of Arabidopsis research approaches, which include RNA-seq profiling across hundreds of accessions and various genetic manipulation techniques used to study gene function.

What expression systems are suitable for producing recombinant At4g32130?

Multiple expression systems can be used to produce recombinant At4g32130, each with distinct advantages:

  • E. coli expression system: Provides high yields and shorter turnaround times, making it ideal for initial characterization studies .

  • Yeast expression system: Offers good yields and shorter production times similar to E. coli, but with some eukaryotic post-translational modifications .

  • Insect cell/baculovirus system: Provides many of the post-translational modifications necessary for correct protein folding .

  • Mammalian cell expression: Capable of producing protein with the most comprehensive post-translational modifications, potentially retaining full activity .

The choice of expression system should be guided by the specific experimental requirements, including the need for post-translational modifications, protein yield, and purification strategy.

What are the specific considerations for expressing At4g32130 in E. coli?

When expressing At4g32130 in E. coli, researchers should consider the following methodological approaches:

  • Vector selection: Use of vectors with strong, inducible promoters (like T7) and appropriate fusion tags (such as the N-terminal His tag used in commercial preparations) .

  • E. coli strain optimization: BL21(DE3) or derivatives are commonly used for recombinant protein expression due to reduced protease activity.

  • Induction conditions: Optimization of IPTG concentration, induction temperature (often lowered to 16-25°C for membrane-associated proteins), and induction duration.

  • Solubility considerations: Since At4g32130 is annotated as potentially membrane-associated, expression conditions may need optimization to prevent inclusion body formation.

  • Lysis buffers: Addition of mild detergents or solubilizing agents may be necessary if the protein associates with membranes.

The standard protocol results in high-purity (>90%) protein as determined by SDS-PAGE .

What purification strategies yield optimal results for recombinant At4g32130?

For His-tagged At4g32130, a multi-step purification strategy is recommended:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resins to capture the His-tagged protein.

  • Buffer composition: Purification buffers typically contain Tris-HCl (pH 8.0), NaCl (150 mM), and potentially mild detergents like sarkosyl (1%) to maintain solubility . Inclusion of glycerol (10%) helps stabilize the protein during purification .

  • Quality control: SDS-PAGE analysis to verify purity (commercial preparations achieve >90% purity) .

  • Additional purification: If necessary, size exclusion chromatography can provide further purification and buffer exchange.

  • Final preparation: Lyophilization for long-term storage or maintenance in solution with appropriate stabilizers .

What are the optimal storage conditions for maintaining At4g32130 stability?

To maintain optimal stability of recombinant At4g32130:

  • Long-term storage: Store lyophilized powder at -20°C or -80°C upon receipt .

  • Working aliquots: Store at 4°C for up to one week to minimize freeze-thaw cycles .

  • Aliquoting strategy: Upon reconstitution, create small working aliquots to avoid repeated freeze-thaw cycles, which can significantly degrade protein quality .

  • Storage buffer: Tris/PBS-based buffer containing 6% trehalose at pH 8.0 provides optimal stability for storage .

A systematic approach to storage validation can be implemented by testing aliquots at different time points to confirm retained activity and structural integrity.

What reconstitution protocols are recommended for At4g32130?

For optimal reconstitution of lyophilized At4g32130:

  • Pre-reconstitution preparation: Briefly centrifuge the vial prior to opening to bring contents to the bottom .

  • Reconstitution medium: Use deionized sterile water to reconstitute the protein to a concentration of 0.1-1.0 mg/mL .

  • Glycerol addition: Add glycerol to a final concentration of 5-50% (with 50% being the default recommendation) to enhance stability .

  • Aliquoting: Create multiple small-volume aliquots for long-term storage at -20°C/-80°C to avoid repeated freeze-thaw cycles .

  • Quality control: Verify protein concentration after reconstitution using spectrophotometric methods or protein assays.

How can researchers verify the identity and integrity of purified At4g32130?

Multiple analytical methods should be employed to verify protein identity and integrity:

  • SDS-PAGE analysis: Confirms the expected molecular weight (approximately 25.8 kDa including the His tag) and provides initial purity assessment .

  • Western blot: Using anti-His antibodies to confirm the presence of the N-terminal His tag.

  • Mass spectrometry: For precise molecular weight determination and potential identification of post-translational modifications or degradation products.

  • Peptide mapping: Tryptic digest followed by LC-MS/MS analysis to confirm sequence coverage.

  • Circular dichroism: To assess secondary structure elements and proper folding.

  • Dynamic light scattering: To evaluate homogeneity and detect potential aggregation.

Combining these approaches provides comprehensive validation of protein identity and quality.

What PCR-based approaches can be used to study At4g32130 in Arabidopsis genetic research?

PCR-based methodologies for studying At4g32130 include:

  • DNA extraction protocol: Extract DNA from Arabidopsis seedlings using standard protocols, which typically involve tissue disruption, lysis, and DNA purification .

  • PCR primer design: Design gene-specific primers targeting At4g32130, considering:

    • Primer specificity to avoid off-target amplification

    • Optimal annealing temperatures (typically 55-62°C)

    • Amplicon size appropriate for downstream applications

  • PCR optimization: Adjust conditions including Mg²⁺ concentration, annealing temperature, and cycle number for optimal amplification .

  • Genotyping applications: PCR can be used to identify plants carrying mutations or transgenes related to At4g32130.

  • Expression analysis: RT-PCR or qRT-PCR to quantify At4g32130 transcript levels under different experimental conditions.

These approaches integrate with broader Arabidopsis research methodologies established within the plant molecular biology community.

How does the study of At4g32130 relate to cyclin-dependent kinase research in Arabidopsis?

While At4g32130 itself is not directly identified as a cyclin in the search results, research methodologies used in Arabidopsis cyclin studies provide relevant experimental approaches:

  • Protein-protein interaction studies: Techniques like yeast two-hybrid analysis and co-immunoprecipitation can be applied to identify potential interactions between At4g32130 and other proteins, including CDKs .

  • Expression pattern analysis: Methods to characterize expression in both proliferating cells and differentiating/mature tissues, similar to approaches used for P-type cyclins in Arabidopsis .

  • Complementation assays: Functional studies through heterologous expression in model systems, similar to how CYCP4;2 was tested for its ability to re-establish phosphate-dependent gene expression in yeast .

  • Mutation analysis: Creating and characterizing knockout or knockdown lines to study the phenotypic effects of At4g32130 disruption.

These methodologies can be adapted to study potential roles of At4g32130 in cell cycle regulation or other cellular processes.

What research design approaches are most effective for studying At4g32130 function?

Effective research design for studying At4g32130 function requires:

  • Clear research question formulation: Define specific hypotheses about At4g32130 function that can be tested experimentally .

  • Appropriate controls: Include positive and negative controls in all experiments to validate findings and minimize research bias .

  • Multiple methodological approaches: Combine genetic, biochemical, and cell biological techniques to build a comprehensive understanding of protein function.

  • Time efficiency: Design experiments that reduce inaccuracy while maximizing reliability and minimizing time wastage .

  • Structured research plan: Develop a coherent strategy that combines different research components logically, including:

    • Genetic manipulation (knockout/knockdown/overexpression)

    • Biochemical characterization

    • Subcellular localization

    • Expression pattern analysis

    • Phenotypic characterization

This systematic approach helps reach maximum reliability while eliminating research bias .

How can phosphoproteomics approaches be applied to study At4g32130?

Phosphoproteomics methodologies can provide insights into At4g32130 regulation and signaling:

  • Sample preparation: Extract proteins from Arabidopsis tissues under different conditions (e.g., stress treatments, developmental stages).

  • Phosphopeptide enrichment: Use techniques like TiO₂ chromatography or IMAC to isolate phosphorylated peptides.

  • Mass spectrometry analysis: Employ LC-MS/MS to identify and quantify phosphopeptides.

  • Data analysis: Compare phosphorylation patterns between wild-type and mutant plants or between different treatment conditions.

  • Functional validation: Confirm the role of specific phosphorylation sites through site-directed mutagenesis (e.g., phospho-mimetic or phospho-dead mutations).

This approach can reveal how At4g32130 participates in phosphorylation cascades, particularly in the context of stress responses, as has been done for other Arabidopsis proteins .

What comparative genomics approaches can reveal insights about At4g32130 function?

Comparative genomics approaches to study At4g32130 include:

  • Sequence alignment analysis: Compare At4g32130 sequences across plant species to identify conserved domains and residues that may be functionally important.

  • Phylogenetic analysis: Construct phylogenetic trees to understand the evolutionary history of At4g32130 and related proteins.

  • Synteny analysis: Examine the conservation of genomic regions surrounding At4g32130 across species to identify potential functional relationships.

  • Expression correlation networks: Analyze co-expression data from resources like the 1001 Epigenomes Project to identify genes with similar expression patterns, suggesting potential functional relationships.

  • Integrative -omics approaches: Combine genomics, transcriptomics, and proteomics data to build comprehensive functional networks that include At4g32130.

These approaches can place At4g32130 in an evolutionary and functional context, providing insights into its biological role even in the absence of direct experimental evidence.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.