Recombinant Arabidopsis thaliana UPF0496 protein At1g20180 (At1g20180)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify this during your order; we will prioritize fulfilling your request.
Synonyms
At1g20180; T20H2.5; UPF0496 protein At1g20180
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-390
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At1g20180
Target Protein Sequence
MLKVKNFLGSRLKSFPTRKGKSDKECCRSLTSKLSVNEEYKEAFRTNSYLETRTKAEDQL GITSCSKLSSSSPSPSSSSDLSFHSHFTDYLLDPPQETLDALMQDSSLDNLIVTFFDLSS EACDVCETLLQCLQQIKINHNKIKRVMKIGKRVCNGAKTLECSPEMLCALIFQELSRFAA LKNPLCRIVNEAQFRIVHDANSDLLTKLTSKKRRIRRKIRFFKFCKKLGGYSLVITHSAI VITLLIIALHSILGVFAAPALLGLCSFCLLRKKKAKGRMHKSNKDTTLEKLGTQIDIAAK GMFILINDLDTLSRLAGRLCDEIEHRKTVAAMCAKSRKIEVLKEALREFNGHEEKFSDQL QELEEHLYLCFHTINRSRRLVLAQITGQSS
Uniprot No.

Target Background

Database Links

KEGG: ath:AT1G20180

STRING: 3702.AT1G20180.1

UniGene: At.50782

Protein Families
UPF0496 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is UPF0496 protein At1g20180?

UPF0496 protein At1g20180 is a protein expressed in Arabidopsis thaliana (Mouse-ear cress), classified as an uncharacterized protein family (UPF) member. The protein is a translation product of the At1g20180 gene in Arabidopsis thaliana and is described in database entries as "similar to unknown protein," indicating limited functional characterization to date . The protein has been assigned UniProt accession number Q6DYE5, which serves as its unique identifier in protein databases .

How is recombinant At1g20180 protein typically produced?

Recombinant At1g20180 protein is typically produced using a mammalian cell expression system as indicated in commercial preparations . The recombinant protein product is available in both liquid and lyophilized forms, with specific storage requirements to maintain stability. Production typically yields a protein with >85% purity as determined by SDS-PAGE analysis . For experimental use, the protein may require reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage stability .

What is known about the expression pattern of the At1g20180 gene?

Microarray data indicates that At1g20180 expression is significantly upregulated (4.73 log2 ratio) after 3 hours of combined abscisic acid and salicylic acid (ABA+SA) treatment in Arabidopsis cell cultures . Interestingly, the gene shows minimal response when treated with either ABA or SA individually (0.16 and 0.38 log2 ratio respectively), suggesting a unique synergistic response to the combined hormone treatment . This expression pattern distinguishes it from typical ABA- or SA-responsive genes, pointing to a potential role in cross-talk between these hormone signaling pathways.

How should recombinant At1g20180 protein be stored for optimal stability?

Optimal storage conditions for recombinant At1g20180 protein depend on its formulation. The liquid form has a shelf life of approximately 6 months when stored at -20°C/-80°C, while the lyophilized form remains stable for up to 12 months at the same temperature range . For working aliquots, storage at 4°C is recommended for up to one week. To maintain protein integrity, repeated freezing and thawing cycles should be avoided . When reconstituting the protein, adding glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) helps maintain stability during long-term storage .

What experimental evidence exists for At1g20180's role in hormone response pathways?

The most compelling evidence for At1g20180's involvement in hormone signaling comes from microarray analyses demonstrating significant upregulation (4.73 log2 ratio) specifically in response to combined ABA+SA treatment . This expression pattern places At1g20180 among the top 25 genes uniquely regulated by the ABA+SA combination rather than by either hormone individually . This distinctive expression profile suggests the protein may function at the intersection of ABA and SA signaling pathways, potentially mediating cross-talk between stress responses. The table below summarizes the expression ratios of At1g20180 under different hormone treatments:

Treatment3-hour expression ratio (log2)24-hour expression ratio (log2)
ABA+SA4.730.16
ABA only0.220.08
SA only0.380.14

This expression pattern distinguishes At1g20180 from typical hormone-responsive genes that show antagonistic interactions between ABA and SA pathways .

How does the protein structure of At1g20180 compare to other UPF0496 family members?

While detailed structural analysis of At1g20180 is limited in the available literature, we can draw comparisons with another UPF0496 family member in Arabidopsis, At2g18630 . Both proteins belong to the same uncharacterized protein family (UPF0496) and are expressed in Arabidopsis thaliana . Sequence-based classification places them in the same family, suggesting structural similarities despite potentially different functional roles, as evidenced by their distinct expression patterns in response to hormone treatments . A comprehensive sequence alignment and structural prediction analysis would be necessary to identify conserved domains that might provide insights into functional mechanisms.

What methodological approaches are recommended for studying At1g20180 function in planta?

To investigate At1g20180 function in planta, researchers should consider a multi-faceted approach:

  • Gene knockout/knockdown studies using T-DNA insertion lines or CRISPR-Cas9 gene editing to assess phenotypic changes, particularly under combined ABA and SA treatment conditions.

  • Overexpression studies with fluorescent protein tagging to determine subcellular localization and potential protein interaction networks.

  • Hormone response assays comparing wild-type and mutant plants under single and combined hormone treatments, following protocols similar to those described in Okamoto et al. where cultured cells were treated with 25 μM ABA and 300 μM SA .

  • Transcriptomic analysis to identify genes co-regulated with At1g20180, particularly in response to combined ABA and SA treatments, using methods similar to the microarray analysis performed with the Affymetrix ATH1 Genome Array .

  • Protein-protein interaction studies using techniques such as yeast two-hybrid or co-immunoprecipitation to identify potential interaction partners that may provide functional insights.

What is the significance of At1g20180's unique response to combined ABA+SA treatment?

The synergistic upregulation of At1g20180 in response to combined ABA+SA treatment (4.73 log2 ratio) versus minimal response to individual hormones (0.22 for ABA, 0.38 for SA) suggests a specialized role in integrating signals from both hormone pathways . This is particularly significant because ABA and SA signaling pathways typically exhibit antagonistic interactions, with many ABA-inducible genes being repressed by SA treatment and vice versa . At1g20180 represents an exception to this antagonistic relationship, potentially serving as a convergence point for these two stress hormone signaling pathways. This unique expression pattern may indicate involvement in plant stress responses that require coordination between ABA-mediated abiotic stress responses and SA-mediated defense responses.

What are the optimal conditions for reconstituting recombinant At1g20180 protein for in vitro studies?

For optimal reconstitution of recombinant At1g20180 protein:

  • Briefly centrifuge the protein vial before opening to ensure all content is at the bottom .

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • For long-term storage, add glycerol to a final concentration of 5-50%, with 50% being the standard recommendation .

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles, which can compromise protein integrity .

  • For working samples, store at 4°C for up to one week; for longer storage, maintain at -20°C or preferably -80°C .

  • When designing experiments, consider that the recombinant protein is described as "partial," indicating it may not represent the complete native protein sequence .

How should hormone treatment experiments be designed to study At1g20180 gene expression?

Based on the experimental design used in published research, the following methodology is recommended for studying At1g20180 expression in response to hormones:

  • Culture preparation: Use Arabidopsis thaliana cell cultures maintained in flasks at 100 rpm on a rotary shaker at 24°C under a 16:8 h light/dark cycle .

  • Hormone treatments:

    • ABA treatment: Apply 25 μM ABA

    • SA treatment: Apply 300 μM SA

    • Combined ABA+SA treatment: Apply both hormones simultaneously

    • Control: Culture medium without hormone additions

  • Time points: Collect samples at both early (3 hours) and late (24 hours) time points to capture both immediate and sustained expression changes .

  • RNA extraction and analysis: Extract total RNA using Trizol reagent, purify with an RNeasy purification kit, and analyze gene expression using microarray (Affymetrix ATH1 Genome Array) or RT-qPCR .

  • Data analysis: Calculate expression ratios relative to untreated controls, and perform statistical analysis to determine significance of expression changes .

What controls should be included when analyzing At1g20180 function in stress response experiments?

When designing experiments to investigate At1g20180 function in stress responses, the following controls should be included:

  • Hormone treatment controls:

    • Single hormone treatments (ABA only, SA only) to compare with combined treatments

    • Mock treatments (solvent only) to account for any effects of the delivery vehicle

    • Time course sampling to distinguish between early and late response genes

  • Genetic controls:

    • Wild-type plants or cells as baseline controls

    • Known ABA-responsive and SA-responsive mutants to benchmark responses

    • Mutants in genes with similar expression patterns to At1g20180 (other genes from the top 25 list of ABA+SA responsive genes)

  • Experimental validation controls:

    • Use of multiple biological replicates (at least three)

    • Technical replicates for RT-qPCR analysis

    • Housekeeping genes such as ACTIN2 as internal controls for expression normalization

    • Multiple stress conditions to determine specificity of At1g20180 response

How should researchers interpret contradictory data about At1g20180 function?

When encountering contradictory data regarding At1g20180 function, researchers should:

  • Compare experimental conditions between studies, particularly hormone concentrations, treatment duration, and plant developmental stages, as these factors can significantly influence gene expression patterns.

  • Consider tissue-specific effects, as gene function may vary between different plant tissues or cell types.

  • Evaluate genetic background differences, as ecotype variations in Arabidopsis can affect hormone responses and stress signaling.

  • Assess the sensitivity and specificity of different experimental techniques used across studies, recognizing that methodological differences can contribute to divergent results.

  • Examine temporal dynamics, as contradictions may result from analyzing different time points in signaling pathways, considering that At1g20180 shows different expression ratios at 3-hour versus 24-hour time points .

  • Consider potential functional redundancy with other UPF0496 family members, such as At2g18630, which may compensate for At1g20180 loss in certain experimental conditions .

What research gaps currently exist in understanding At1g20180 function?

Several significant knowledge gaps remain in understanding At1g20180 function:

  • Protein structure: Detailed structural information for At1g20180 is lacking, limiting understanding of functional domains and potential interaction surfaces.

  • Subcellular localization: Information about where At1g20180 functions within the cell would provide important functional insights.

  • Protein interactions: The interaction partners of At1g20180 remain unknown, limiting understanding of its role in signaling networks.

  • Physiological role: How the strong upregulation in response to combined ABA+SA treatment translates to specific physiological functions remains unclear.

  • Post-translational modifications: Whether At1g20180 undergoes regulatory modifications that affect its function has not been determined.

  • Conservation and evolution: The evolutionary significance of the UPF0496 protein family across plant species and its conservation of function require further investigation.

  • Phenotypic effects: The consequences of At1g20180 mutation or overexpression on plant development and stress responses have not been fully characterized.

What emerging technologies could advance understanding of At1g20180 function?

Several cutting-edge technologies could significantly advance our understanding of At1g20180 function:

  • Cryo-electron microscopy: To determine the protein's three-dimensional structure, providing insights into functional domains and potential interaction surfaces.

  • Proximity labeling approaches (BioID, TurboID): To identify proteins in close proximity to At1g20180 in vivo, helping map its interaction network.

  • Single-cell transcriptomics: To characterize cell-type-specific expression patterns of At1g20180 under various stress conditions.

  • ChIP-seq and DAP-seq: To identify potential transcription factors regulating At1g20180 expression in response to hormone treatments.

  • Phosphoproteomics: To determine whether At1g20180 undergoes phosphorylation or other post-translational modifications in response to hormone signaling.

  • CRISPR-Cas9 base editing: For precise modification of specific amino acids to assess their functional importance without complete gene disruption.

  • AlphaFold or RoseTTAFold: To generate computational models of protein structure when experimental structures are unavailable.

How might At1g20180 research contribute to understanding plant stress response mechanisms?

Research on At1g20180 could significantly contribute to understanding plant stress responses in several ways:

  • Cross-talk mechanisms: As a gene specifically upregulated by combined ABA+SA treatment, At1g20180 may represent a key integration point between abiotic stress (mediated by ABA) and biotic stress (mediated by SA) response pathways .

  • Signaling pathway coordination: Understanding how At1g20180 responds to combined hormone signals could reveal mechanisms by which plants prioritize or integrate multiple stress signals.

  • Regulatory networks: Identifying the transcription factors controlling At1g20180 expression could uncover novel regulatory circuits in stress response networks.

  • Evolutionary adaptation: Comparative studies of UPF0496 family members across plant species could provide insights into the evolution of stress response mechanisms.

  • Application potential: Knowledge of genes like At1g20180 that integrate multiple stress signals could inform development of crops with improved resilience to combined stresses, which are common in field conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.