Recombinant Arabidopsis thaliana UPF0496 protein At2g18630 (At2g18630)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
At2g18630; F24H14.1; MSF3.1; UPF0496 protein At2g18630
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-393
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At2g18630
Target Protein Sequence
MMGGKSSKSKKNVEFGSPSTPVQIKINSEYTEHLSSYERACSEDPKLESFDSALHERTNR VINKLASGVEIKSLSFDSLREVTQCLLDMNQDVVKVILQDKEDIWNNQDLFSLVNLYFES TAKTMDFCSELENCLNRARRSQVIIQFAVNQFEEENEDKENRKYEKTLEELKRFKVAGEP FTKEFFALFDLVYKQQVMMLEELHKLKRKLDKRLRNIKTWRRVSNMVFVTAFVSVLIFSV VAAAVAAPPVVAAIAGALAVPVGSVGKWCNTLWTKYEKVVRGQKEIITSIRIGTYISVKE MDNISILVRKVEVEIESLLKKAEFAITEEKEVRLAIDEIKKKLDVFTETIEELGEHAGKY CSDVTKARTVILQRIIRYPAGSPKDEAPWTEMM
Uniprot No.

Target Background

Database Links

KEGG: ath:AT2G18630

STRING: 3702.AT2G18630.1

UniGene: At.39961

Protein Families
UPF0496 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What functional roles has research established for proteins in the UPF0496 family?

Research has demonstrated that the UPF0496 protein family, to which At2g18630 belongs, is evolutionarily conserved with functions primarily related to manganese (Mn²⁺) transport. Key functional aspects include:

  • Members of this family share a function in Mn²⁺ transport across cellular membranes

  • The protein family has representatives in both prokaryotes and eukaryotes, indicating essential conserved functions

  • In Arabidopsis, related members like PAM71 and CMT1 are involved in manganese transport in chloroplast thylakoid and inner-envelope membranes, respectively

  • The family exhibits functional conservation despite variations in subcellular localization and membrane environments

This functional conservation suggests an essential role in cellular metal homeostasis across evolutionary lineages, with members functioning independently of additional factors or membrane lipid composition .

What methods are used for recombinant expression of UPF0496 protein At2g18630?

Expression of recombinant UPF0496 protein At2g18630 typically employs the following methodological approach:

Expression System Selection:

  • Escherichia coli is commonly used as the expression host due to its simplicity and high yield

  • Alternatively, yeast or insect cell systems may be employed for eukaryotic post-translational modifications

Cloning Strategy:

  • PCR amplification of the At2g18630 coding sequence from Arabidopsis cDNA using high-fidelity polymerase

  • Insertion into appropriate expression vectors with tags for purification (His-tag, GST, etc.)

  • Sequence verification to confirm correct insertion and orientation

Expression Conditions:

  • Temperature optimization (typically 16-28°C)

  • IPTG concentration adjustment for induction

  • Growth medium selection (rich vs. minimal media)

  • Expression time optimization (4-24 hours)

Purification Protocol:

  • Cell lysis using buffer containing detergents suitable for membrane proteins

  • Affinity chromatography (typically using Ni-NTA for His-tagged proteins)

  • Optional tag removal using specific proteases

  • Size exclusion chromatography for final purification

Storage Recommendations:

  • Storage at -20°C in Tris-based buffer with 50% glycerol

  • Aliquoting to avoid repeated freeze-thaw cycles

  • Working aliquots maintained at 4°C for up to one week

How can gene replacement techniques be utilized to investigate the function of UPF0496 protein At2g18630?

Gene replacement provides powerful insights into protein function through comparative analysis of orthologs. For UPF0496 protein At2g18630, researchers have employed these sophisticated approaches:

Methodological Workflow:

  • Vector Construction:

    • Clone the cTP (chloroplast-targeting peptide) sequence into an entry vector (pENTR)

    • Amplify fragments using high-fidelity DNA polymerase with appropriate restriction sites

    • Digest PCR products with restriction enzymes (e.g., XhoI)

    • Ligate fragments and verify through sequencing

  • Transformation Protocol:

    • Transform Arabidopsis using the floral-dip method with Silwet L-77 as the detergent

    • Select transformants on appropriate antibiotics

    • Confirm transformation through PCR genotyping

  • Functional Analysis:

    • Evaluate phenotypic complementation through growth assays

    • Compare wild-type, knockout, and complemented lines

    • Analyze protein localization using fluorescent tags (e.g., GFP fusion proteins)

  • Protein Localization Assessment:

    • Use LC-MS/MS approaches to quantify protein distribution between membrane fractions

    • Enrich thylakoid and envelope membranes using sucrose-density gradient centrifugation

    • Compare distribution of marker proteins to validate fractionation quality

Key Research Findings:
Replacement experiments using related UPF0496 family members have demonstrated that eukaryotic and cyanobacterial transporters can functionally complement each other in heterologous systems, indicating conservation of the core transport function across evolutionary lineages. These experiments reveal that UPF0016 members function independently of additional factors and membrane lipid composition .

What post-transcriptional gene silencing (PTGS) approaches can be applied to study UPF0496 protein At2g18630 expression?

PTGS offers powerful tools for examining UPF0496 protein At2g18630 function through targeted gene silencing. Recent advancements provide sophisticated approaches:

RNAi-Mediated Silencing Strategy:

  • Vector Design:

    • Construct inverted-repeat sequences targeting At2g18630

    • Clone under tissue-specific promoters (e.g., phloem companion cell-specific)

    • Include appropriate selection markers

  • Chemical Enhancement of Silencing:
    Several compounds can enhance PTGS efficiency:

    CompoundOptimal ConcentrationMechanismEnhancement Level
    Sortin1100-350 ppmEnhances 21-nt siRNA accumulation35% normalized enhancement
    Isoxazolone100-350 ppmIncreases siRNA loading into AGO155-60% normalized enhancement
    DFPM100-350 ppmReduces AGO4 and DCL3 levels55-60% normalized enhancement
  • Silencing Assessment:

    • Monitor transcript levels through RT-qPCR

    • Quantify protein expression via western blotting

    • Observe phenotypic changes in transformed plants

  • siRNA Analysis:

    • Characterize siRNA populations (21-nt vs. 24-nt)

    • Analyze AGO loading preferences

    • Evaluate processing efficiency in dicing assays

Research Implications:
Chemical enhancers specifically increase DCL4-mediated processing of double-stranded RNAs in seedling extracts, targeting a previously unknown PTGS component likely independent of the DCL4-cofactor DOUBLE-STRANDED RNA-BINDING 4 (DRB4). Such enhancement can significantly improve silencing efficiency for At2g18630 studies .

What experimental approaches are effective for analyzing protein-protein interactions involving UPF0496 protein At2g18630?

Investigating protein-protein interactions involving UPF0496 protein At2g18630 requires specialized techniques adapted for membrane proteins:

Affinity Chromatography Strategies:

  • Polymyxin-Based Approach:

    • Immobilize protein on polymyxin resin

    • Incubate with plasma membrane-enriched fractions

    • Elute and identify binding partners via mass spectrometry

    • Exclude non-specific binding proteins using control matrices

  • Biotinylation and Streptavidin Capture:

    • Biotinylate the protein through transesterification reactions

    • Capture using streptavidin magnetic polymeric microspheres

    • Analyze elution profiles spectrophotometrically

    • Identify interacting proteins through LC-MS/MS

  • Recombinant Fusion Protein Strategy:

    • Express UPF0496 protein At2g18630 as a staphylococcal protein A fusion

    • Separate proteins using SDS-PAGE

    • Transfer to nitrocellulose membranes

    • Visualize through direct binding with HRP-conjugated immunoglobulin

Mass Spectrometry Analysis:

  • Apply threshold Byonic™ scores and log probability to filter results

  • Compare against control (non-specific binding) proteins

  • Group identified proteins by functional categories

  • Prioritize proteins involved in perception and defense signaling

How can transcriptome analysis be applied to understand UPF0496 protein At2g18630 function in stress response?

Transcriptomic approaches offer comprehensive insights into how UPF0496 protein At2g18630 functions during stress responses:

Experimental Design for Stress Response Studies:

  • Growth Conditions:

    • Culture seedlings in controlled environment (temperature, light, humidity)

    • Apply stress treatments (e.g., drought, phosphate limitation)

    • Include appropriate controls and time-course sampling

  • RNA Extraction and Sequencing:

    • Extract high-quality RNA from treated and control samples

    • Prepare libraries for RNA-seq

    • Perform deep sequencing on appropriate platforms

  • Data Analysis Pipeline:

    • Quality control and filtering of raw reads

    • Alignment to reference genome

    • Differential expression analysis

    • Gene Ontology enrichment

  • Validation Approaches:

    • RT-qPCR for selected genes

    • Protein expression analysis

    • Phenotypic evaluation

Experimental Results:
Recent studies examining responses to stresses like drought have shown differential gene expression patterns that can be quantified using RNA-seq. For example, drought-mimicking conditions on agar media resulted in 868 and 2,169 genes differentially expressed in roots and shoots, respectively, with many showing dose-responsive patterns comparable to other treatments .

What advanced data analysis methods are most effective for interpreting UPF0496 protein At2g18630 research results?

Comprehensive data analysis is crucial for extracting meaningful insights from UPF0496 protein At2g18630 research:

Advanced Analytical Approaches:

  • Integration of Mixed Methods:

    • Combine qualitative and quantitative data through visual joint displays

    • Apply statistics-by-themes and side-by-side comparisons

    • Connect findings to theoretical frameworks

  • Gene Expression Data Analysis:

    • Transform raw microarray data into gene expression matrices

    • Apply supervised and unsupervised analytical methods

    • Predict gene function classes through comparative analysis

    • Use expression matrices to identify potential regulatory signals

  • Quality Assessment in Meta-Analysis:

    • Apply the GRADE approach (Grading of Recommendations Assessment, Development and Evaluation)

    • Assess evidence quality through risk of bias, inconsistency, indirectness, imprecision, and publication bias

    • Summarize findings in standardized tables with certainty ratings

  • Experimental Design Optimization:

    • Define variables (independent, dependent, control, confounding)

    • Formulate testable hypotheses

    • Design appropriate treatments and controls

    • Apply statistical approaches for validation

Results Interpretation Guidelines:
For experimental designs investigating UPF0496 protein At2g18630, researchers should clearly define independent variables (e.g., stress conditions, genetic modifications) and dependent variables (e.g., protein expression, phenotypic changes). Control variables must be rigorously maintained to isolate the effects of manipulations and avoid confounding factors .

How can computational approaches predict the functional domains of UPF0496 protein At2g18630?

Computational analysis provides valuable insights into functional domains of UPF0496 protein At2g18630 without extensive wet-lab experimentation:

Computational Methodology:

  • Sequence-Based Analysis:

    • Multiple sequence alignment with homologs

    • Identification of conserved motifs and domains

    • Phylogenetic analysis to establish evolutionary relationships

  • Structural Prediction:

    • Secondary structure prediction using algorithms like PSIPRED

    • Tertiary structure modeling using homology modeling or ab initio approaches

    • Identification of functional sites through structure comparison

  • Protein Family Classification:

    • Domain architecture analysis

    • Comparison with characterized members of UPF0496 family

    • Assessment of transmembrane topology

  • Functional Inference:

    • Gene Ontology term prediction

    • Protein-protein interaction network analysis

    • Subcellular localization prediction

Research Findings:
Phylogenetic analysis has revealed that UPF0496 protein At2g18630 belongs to an evolutionarily conserved family with representatives across various organisms. The protein contains the characteristic structure of UPF0016 family members, with two regions of three transmembrane domains each, connected by an acidic loop. The conserved motif Glu-x-Gly-Asp-(Arg/Lys)-(Ser/Thr) in TM1 and TM4 suggests essential functional roles .

The evolutionary relationship between UPF0496 protein At2g18630 and other family members can be quantified through pairwise comparisons, as demonstrated in studies of related proteins:

Protein PairsAmino Acid DifferencesStandard Error
Arabidopsis PAM71 - CMT124712.9
Arabidopsis PAM71 - PML328713.5
Arabidopsis PAM71 - Human TMEM16532914.7
Arabidopsis PAM71 - Synechocystis MNX29414.6

These analyses help establish evolutionary relationships and predict functional conservation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.