The query refers to "Recombinant Arabidopsis thaliana UPF0496 protein At3g19250," which is a protein found in the plant Arabidopsis thaliana. The name "UPF0496" indicates that this protein belongs to a protein family of unknown function (UPF) and is listed as family number 0496. "At3g19250" is the gene identifier for this protein in the Arabidopsis thaliana genome.
Proteins in the AIG2-like family have diverse functions, ranging from $$ \gamma $$-glutamyl cyclotransferase activity to roles in plant responses to chemical and biotic stimuli . The expression patterns of At3g19250 and its paralogs suggest specialized physiological roles for each . A human homolog of this protein shows elevated expression in bladder cancer tissues .
Research indicates that proteins in Arabidopsis thaliana play a role in the plant's defense responses. For example, LPS (lipopolysaccharide) derived from Xanthomonas campestris pv. campestris (Xcc) can elicit immune responses in Arabidopsis thaliana, signified by a rapid influx of calcium ions and the production of reactive oxygen and nitrogen species . Additionally, LPS-interacting proteins in B. cepacia suggest that perception of lipoglycans may occur within membrane rafts/microdomains .
Phosphorylation events during plant defense responses are also relevant to At3g19250. Studies involving virulent Pseudomonas syringae pv. maculicola ES4326 (Psm ES4326) have identified significantly altered phosphoproteins in systemic tissues of locally pathogen-inoculated plants . These proteins are involved in plant-pathogen interactions, amino acid metabolism, photosynthesis, mitogen-activated protein kinase (MAPK) signaling, and secondary metabolism .
| Protein | Fold Change | P-value |
|---|---|---|
| MPK3 | Increased | < 0.05 |
| MPK6 | Increased | < 0.05 |
| ABCG36 | Decreased | < 0.05 |
| ABCG12 | Decreased | < 0.05 |
| ABCC4 | Decreased | < 0.05 |
Note: This table summarizes the changes in phosphorylation levels of selected proteins during SAR establishment. MPK3/6 are key factors in defense responses, while ABC transporters like ABCG36, ABCG12 and ABCC4 are involved in transporting various substrates, including defense compounds .
Arabidopsis thaliana has a complex interactome, with over 95,000 protein-protein interactions involving 27,416 protein-coding genes . This highlights the importance of understanding protein interactions to decipher the functions of proteins like At3g19250.
KEGG: ath:AT3G19250
UniGene: At.50199
The UPF0496 protein At3g19250 (UniProt ID: Q9LJK4) is a 360-amino acid protein from the model plant Arabidopsis thaliana. It belongs to the UPF0496 protein family, with synonyms including MVI11.17 . The recombinant form is typically expressed in E. coli with an N-terminal His tag to facilitate purification and detection .
The protein's full amino acid sequence is: MPHCFTFKPASPEGSLGDDHLPHPSPEGSVASTFNLSHELAHAFQTPSYHDIRSRLLVIDPTQENLELFLSQELRPNNESVQEALSLRHAKQTTLTNLVSTYFQHSEDATRFCLNLYQNVHSARCHLYTPLLDLFNIFPRDSHSAIDESFCNLAFDVFLKLDTFENPFASPESHSFQDTQLCFYQLADKLDTRIRKSKSRVRLLHHATAGSALCLVTAVVVVAASAAFIAYHALPTILVVAGPLCTPYLPHSFKKKELSNIFQLNVAAKGTFALNKDLDTIDRLVSRLHTGVKNDKLLIR
LGLERGRDVYTIPEFVKQLRKSHVNHTHQLEVLVDHICRWFTNVNKSRSLLLKEILRPQT . Analysis of this sequence reveals potential transmembrane domains and structural motifs that may be relevant for functional studies.
Recombinant At3g19250 protein is typically supplied as a lyophilized powder and requires proper storage and handling to maintain activity . For long-term storage, the protein should be kept at -20°C to -80°C upon receipt, with aliquoting necessary to prevent repeated freeze-thaw cycles which can degrade protein quality . Working aliquots may be stored at 4°C for up to one week .
The protein is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 . Trehalose serves as a cryoprotectant to maintain protein stability during freeze-thaw cycles. When reconstituting the lyophilized protein, it is recommended to use deionized sterile water to a concentration of 0.1-1.0 mg/mL and to add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) before aliquoting for long-term storage .
Prior to opening the vial containing lyophilized recombinant At3g19250 protein, it should be briefly centrifuged to ensure the contents are at the bottom of the vial . The protein should be reconstituted in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL . For long-term storage preparations, glycerol should be added to a final concentration of 5-50%, with 50% being the standard recommendation to prevent freeze damage .
After reconstitution, the solution should be gently mixed to ensure complete solubilization without causing protein denaturation. The reconstituted protein can be used immediately for experiments or aliquoted and stored as described in section 1.2. Before using in experiments, it's advisable to check protein quality by SDS-PAGE to confirm purity is greater than 90% as specified by the manufacturer .
Studying the function of At3g19250 in Arabidopsis can employ several established methodologies used in plant molecular biology research. One effective approach is to conduct gene expression analyses under various environmental conditions, such as water stress, as detailed in multiple Arabidopsis transcriptome studies .
For water potential response studies, seedlings can be grown on vertical plates for 8 days under short-day conditions (8 hr light, 21°C, 150 μmoles light) on agar media containing 1× LS media, 1% sucrose, and 2% agar at pH 5.7 . Transferring plants to high agar (HA) plates with increased nutrient and agar concentration (1.25×, 1.67×, and 2.5× fold increase) can simulate controlled water limitation conditions . Tissue samples should be collected at specific timepoints (e.g., 2 hours after subjective dawn) and flash-frozen for subsequent RNA extraction and analysis .
For protein interaction studies, co-immunoprecipitation (co-IP) experiments can be performed using epitope-tagged versions of At3g19250, similar to methods described for other Arabidopsis proteins like HDA9 and PWR . This approach would involve generating transgenic Arabidopsis plants expressing tagged At3g19250 under its native promoter or an inducible system.
Several complementary approaches can be employed to identify and characterize At3g19250 protein-protein interactions in research settings. Immunoprecipitation coupled with mass spectrometry (IP-MS) is a powerful technique for discovering novel protein interactions, as demonstrated in studies of other Arabidopsis proteins . This approach would involve generating transgenic plants expressing epitope-tagged At3g19250 (e.g., At3g19250-3xFLAG) driven by its native promoter, followed by protein extraction, immunoprecipitation, and mass spectrometry analysis to identify co-precipitating proteins .
Validation of identified interactions can be performed using reciprocal co-immunoprecipitation in plants expressing both At3g19250 and its putative interacting partner with different epitope tags . For instance, if an interaction with Protein X is suspected, F1 Arabidopsis plants expressing both HA-tagged At3g19250 and FLAG-tagged Protein X could be generated. Pull-down with anti-FLAG beads followed by western blot detection with anti-HA antibody would confirm the interaction .
In vitro methods can complement in vivo approaches. GST pull-down assays using recombinant At3g19250 and its putative interacting partners expressed in bacterial systems can provide direct evidence of physical interactions . These methods have been successfully applied to study interactions between other Arabidopsis proteins and could be adapted for At3g19250.
Understanding At3g19250 expression patterns under various environmental conditions requires well-designed transcriptome analyses. While specific information about At3g19250 regulation is limited in the provided sources, methodologies from Arabidopsis stress response studies can be applied to investigate its expression patterns.
To study regulation under water limitation, multiple approaches can be implemented. The vermiculite drying system allows for controlled water limitation where Arabidopsis seedlings are grown on vertical plates for 17 days, transferred to vermiculite saturated with media, and then subjected to controlled drying by measuring field capacity (FC) . Tissue samples collected at regular intervals during the drying process can reveal dynamic expression changes of At3g19250 in response to water limitation .
Alternatively, the high agar (HA) approach provides a more controlled system where water potential is lowered by increasing nutrient and agar concentration . This method has been validated to induce gene expression responses comparable to vermiculite drying and could be used to assess At3g19250 expression changes under defined water potential conditions .
Hormone treatments, particularly abscisic acid (ABA), can also provide insights into At3g19250 regulation. Protocols involving treatment of Arabidopsis seedlings with different concentrations of ABA (1 μM, 5 μM, and 10 μM) followed by RNA extraction and transcriptome analysis can reveal whether At3g19250 is regulated by this stress hormone .
Chromatin immunoprecipitation followed by quantitative PCR (ChIP-qPCR) is an effective approach to investigate proteins that bind to the At3g19250 genomic region and potential epigenetic modifications that regulate its expression . This technique involves crosslinking proteins to DNA, fragmenting chromatin, immunoprecipitating with antibodies against specific proteins or histone modifications, and analyzing the enriched DNA regions .
To identify transcription factors that regulate At3g19250, ChIP-qPCR can be performed using antibodies against candidate transcription factors, similar to studies that identified WRKY transcription factors binding to target genes . For epigenetic regulation, antibodies against specific histone modifications like H3K27ac, which is associated with active transcription, can reveal changes in the epigenetic landscape of At3g19250 under different conditions or in different mutant backgrounds .
Genome-wide approaches like ChIP-seq would provide comprehensive information about transcription factor binding and histone modifications across the entire At3g19250 locus, including promoter and potential enhancer regions. This approach has been successfully used to study other Arabidopsis genes and could be adapted to investigate At3g19250 regulation mechanisms .
CRISPR/Cas9 genome editing offers powerful tools for investigating At3g19250 function through precise genetic modifications. While specific CRISPR protocols for At3g19250 are not detailed in the provided sources, standard Arabidopsis CRISPR methodologies can be adapted.
For complete gene knockout studies, guide RNAs (gRNAs) should be designed to target early exons of At3g19250, preferably within the first third of the coding sequence. Multiple gRNAs can be used simultaneously to increase editing efficiency and create larger deletions that ensure loss of function. For domain-specific functional analysis, gRNAs can be designed to target specific functional domains identified through sequence analysis.
Beyond knockouts, precise modifications can be introduced using homology-directed repair (HDR). This approach allows for introduction of specific mutations or epitope tags to study protein function in its native genomic context. For example, researchers could introduce mutations to specific amino acid residues hypothesized to be important for At3g19250 function based on sequence conservation or structural predictions.
For studying regulatory regions, CRISPR interference (CRISPRi) or CRISPR activation (CRISPRa) systems can be employed. These systems use catalytically inactive Cas9 (dCas9) fused to transcriptional repressors or activators, allowing for modulation of At3g19250 expression without altering its sequence, providing insights into its regulatory mechanisms.
Structural characterization of At3g19250 would provide valuable insights into its molecular function. X-ray crystallography represents a gold standard approach for obtaining high-resolution protein structures. The availability of recombinant His-tagged At3g19250 expressed in E. coli provides a starting point for purification and crystallization attempts . Optimization of protein expression conditions, including choice of expression host, temperature, and induction parameters, can improve protein yield and solubility for structural studies.
For crystallization screening, the purified recombinant At3g19250 should be concentrated to approximately 10-15 mg/ml in a suitable buffer system. Various commercial crystallization screening kits can be employed to identify initial crystallization conditions, followed by optimization to obtain diffraction-quality crystals. If crystallization proves challenging, alternative approaches such as nuclear magnetic resonance (NMR) spectroscopy for smaller domains or cryo-electron microscopy (cryo-EM) for larger complexes could be considered.
Computational approaches, including protein structure prediction using tools like AlphaFold, can provide valuable initial structural models based on the At3g19250 amino acid sequence . These predictions can guide experimental design and interpretation of functional data, particularly for identifying potential binding sites or functional domains within the protein.
Recombinant At3g19250 expression and purification may encounter several challenges that require optimization. Expression in E. coli can result in inclusion body formation, requiring optimization of expression conditions including temperature, IPTG concentration, and duration of induction. Lower temperatures (16-18°C) and reduced IPTG concentrations often increase the proportion of soluble protein.
For proteins that remain insoluble despite optimization, denaturing purification followed by refolding may be necessary. This involves solubilizing inclusion bodies in denaturants like urea or guanidine hydrochloride, followed by gradual removal of the denaturant to allow refolding. Alternative expression systems such as insect cells or yeast could also be explored if E. coli expression remains problematic.
Purification optimization may include adjusting buffer composition, salt concentration, and pH to improve protein stability and yield. The His-tag provided in the recombinant At3g19250 facilitates purification using immobilized metal affinity chromatography (IMAC) , but additional purification steps may be required to achieve high purity. Size exclusion chromatography can remove aggregates and provide information about the oligomeric state of the protein.
Protein stability during storage can be enhanced by adding stabilizing agents like glycerol or trehalose as mentioned in the storage recommendations . Testing protein activity after various storage conditions is important to establish optimal handling protocols for specific experimental applications.
Validating the purity and activity of recombinant At3g19250 is crucial for reliable experimental outcomes. Purity assessment should begin with SDS-PAGE analysis, which should show a single predominant band at the expected molecular weight for His-tagged At3g19250. According to the product specifications, purity should be greater than 90% as determined by SDS-PAGE .
Western blotting using antibodies against the His-tag can confirm the identity of the purified protein. Mass spectrometry analysis provides the most definitive confirmation of protein identity and can detect potential post-translational modifications or truncations.
For activity assessment, suitable functional assays would depend on the known or hypothesized function of At3g19250. Since specific enzymatic activities for this protein are not well-characterized based on the provided information, initial functional studies might include binding assays with potential interaction partners or screening for enzymatic activities based on sequence homology to proteins with known functions.
Thermal shift assays (differential scanning fluorimetry) can provide valuable information about protein stability and proper folding, as well as identify buffer conditions that enhance stability. This method involves monitoring protein unfolding in the presence of a fluorescent dye that binds to hydrophobic regions exposed during denaturation.
Analysis of transcriptomic data for At3g19250 should follow established bioinformatics workflows while incorporating specific considerations for plant gene expression studies. RNA sequencing data should be processed using appropriate tools such as Bowtie2 for read mapping to the Arabidopsis reference genome (TAIR10), followed by Tophat and Cufflink for differential expression analysis .
When analyzing At3g19250 expression patterns, it's important to consider both statistical significance (p<0.05 is typically considered significant) and biological relevance (fold change magnitude) . Temporal expression patterns should be examined across different developmental stages and in response to environmental stimuli, similar to the approach used in water limitation studies .
Comparative analysis with co-regulated genes can provide insights into potential functional pathways involving At3g19250. Gene Ontology (GO) enrichment analysis of genes with similar expression patterns can reveal biological processes, molecular functions, and cellular components associated with At3g19250 function . Tools like agriGO, specifically designed for agricultural and plant species, are particularly useful for this purpose .
Integration of transcriptomic data with other datasets, such as protein-protein interaction networks or chromatin modification profiles, can provide a more comprehensive understanding of At3g19250 function in cellular and physiological contexts. This multi-omics approach is increasingly valuable for generating hypotheses about protein function in complex biological systems.
Selection of appropriate statistical methods for analyzing At3g19250 functional data depends on the experimental design and type of data collected. For comparison of gene expression levels across different conditions or genotypes, statistical methods implemented in software packages like Cufflink are appropriate . These methods account for the specific characteristics of RNA-seq data, including its digital nature and overdispersion.
For phenotypic data, such as growth measurements or stress responses in plants with altered At3g19250 expression, appropriate statistical tests might include t-tests for simple two-group comparisons or ANOVA for multiple group comparisons. The shoot area measurement approach described for different Arabidopsis accessions grown under varying conditions provides a model for quantitative phenotypic analysis .
When analyzing protein-protein interaction data, statistical assessment of enrichment in immunoprecipitation-mass spectrometry experiments is critical. This typically involves comparing peptide counts or intensities between experimental samples and controls, with appropriate normalization and statistical testing to identify significantly enriched interacting proteins .
For ChIP-qPCR or ChIP-seq data analyzing protein binding to genomic regions or histone modifications, statistical analysis should assess enrichment relative to input controls and evaluate the significance of differences between experimental conditions . This approach has been successfully applied to identify genomic binding sites and histone modification changes for other Arabidopsis proteins .
Investigation of At3g19250's role in plant stress responses represents a promising research direction, particularly given the established methods for studying Arabidopsis responses to water limitation . Comparative transcriptomic analysis of wild-type plants versus At3g19250 knockout or overexpression lines under various stress conditions could reveal stress-specific functions and downstream targets.
Integration of physiological measurements, such as photosystem II efficiency (Fv/Fm), with molecular analyses would provide a more comprehensive understanding of At3g19250's role in stress adaptation . This approach has been effectively applied in water limitation studies and could be extended to other stresses including salt, temperature extremes, or pathogen infection.
Investigating potential interactions between At3g19250 and known stress response regulators, such as WRKY transcription factors or histone modifiers like HDA9, could reveal its position within stress signaling networks . Co-immunoprecipitation followed by mass spectrometry (IP-MS) of epitope-tagged At3g19250 under different stress conditions might identify condition-specific interaction partners .
Evolutionary analysis comparing At3g19250 with orthologs in other plant species, particularly those with different stress tolerance characteristics, could provide insights into conserved and species-specific functions. This comparative genomics approach would be particularly valuable for understanding the fundamental biological roles of this UPF0496 family protein.
The potential involvement of At3g19250 in epigenetic regulation represents an intriguing research direction, particularly considering the established roles of other Arabidopsis proteins in chromatin modification and gene expression control . ChIP-seq analysis to map At3g19250 binding sites across the genome would provide initial evidence for potential roles in transcriptional regulation or chromatin organization.
Investigation of histone modification patterns in At3g19250 mutant or overexpression lines could reveal whether this protein influences epigenetic marks such as H3K27ac, which has been studied in the context of other regulatory proteins like HDA9 and PWR . This approach would involve ChIP-qPCR or ChIP-seq using antibodies against specific histone modifications in wild-type versus At3g19250 mutant backgrounds.
Protein interaction studies to identify whether At3g19250 associates with known chromatin modifiers, such as histone deacetylases (HDACs) or methyltransferases, would provide mechanistic insights into potential epigenetic functions . The established protocols for studying interactions between proteins like HDA9 and PWR could be adapted for investigating At3g19250 interactions .
Transcriptome analysis of At3g19250 mutants combined with histone modification profiling could identify sets of genes whose expression and epigenetic status are coordinately regulated by At3g19250, potentially revealing its role in specific developmental or stress-responsive epigenetic programs in Arabidopsis.