Recombinant Arabidopsis thaliana UPF0496 protein At3g28310/At3g28320 (At3g28310/At3g28320)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
At3g28310/At3g28320; MZF16.11/MZF16.13; UPF0496 protein At3g28310/At3g28320
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-384
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At3g28310/At3g28320
Target Protein Sequence
MAFSKDKTSRYSEHVDAYRAACGHHPDLKSFDSKIQQRTSNLIDSLTVEAKTGSVSPHAV HKEVIDIHLVEVSKAVADVITECGEEVWENGTLQSLVKDYFNSTMETLKIFETVTQCVHE AKRGQRYIKAAVAQFKKDSEEKDVGVKKKRYGKTLEELMKFKAMGNPFDDGLLKTQFELM NKQQESLFDRVTETKERIAKEIEEVQKRISNVNTATIVSHVVFGAAAFGYAAGCIALMCT GVGAPLGAGMVTLLPVIVVQWVGVNYVLNNSLEALQKQLKALNKVKPIPERITEGMEADK EGMKSVPEQVDELKDQISSLLQTVDDAIGSEGDEVDVKLDMESLEDDVKTLTTKITEVCE TVAKYSKIIKEARLHVLEKITGTG
Uniprot No.

Target Background

Database Links

KEGG: ath:AT3G28310

UniGene: At.42823

Protein Families
UPF0496 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How is recombinant UPF0496 protein At3g28310/At3g28320 typically produced for research applications?

The most common expression system for production is E. coli with an N-terminal His-tag. This approach facilitates protein purification using affinity chromatography. The recombinant protein is typically expressed as the full-length sequence (384 amino acids) to maintain complete functional domains . Alternative expression systems such as yeast may be used for proteins that require eukaryotic post-translational modifications, as seen with the related UPF0496 protein At4g34320 .

What purification methods yield the highest quality recombinant protein?

A multi-step purification protocol is recommended:

  • Initial capture using Ni-NTA affinity chromatography (exploiting the His-tag)

  • Secondary purification via size exclusion chromatography

  • Final polishing step using ion exchange chromatography if necessary

This approach consistently yields protein with >90% purity as determined by SDS-PAGE . For experiments requiring higher purity, additional chromatography steps may be necessary.

What are the optimal storage conditions for maximizing protein stability?

For long-term storage, the following protocol is recommended:

Storage FormTemperatureBuffer CompositionExpected Stability
Lyophilized powder-20°C/-80°CTris/PBS-based, pH 8.012 months
Liquid aliquots-20°C/-80°CTris/PBS with 50% glycerol6 months
Working aliquots4°CTris/PBS with 6% Trehalose1 week

Avoid repeated freeze-thaw cycles as they significantly decrease protein activity. For experiments requiring multiple uses, prepare small working aliquots rather than repeatedly freezing and thawing the main stock .

What is the recommended reconstitution protocol for lyophilized protein?

For optimal reconstitution:

  • Briefly centrifuge the vial to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% for storage stability

  • Aliquot into small volumes to avoid repeated freeze-thaw cycles

  • Flash freeze in liquid nitrogen before transferring to long-term storage at -20°C/-80°C

This protocol maintains protein conformation and activity while minimizing aggregation or precipitation.

How can chromatin immunoprecipitation (ChIP) be optimized for studying UPF0496 protein interactions?

Based on studies with other Arabidopsis chromatin-associated proteins such as DEK3, a modified ChIP protocol is recommended:

  • Crosslink plant tissue with 1% formaldehyde for 10 minutes under vacuum

  • Quench with 0.125M glycine for 5 minutes

  • Extract and sonicate chromatin to fragments of 200-500 bp

  • Immunoprecipitate using anti-His antibodies for the tagged recombinant protein

  • Perform stringent washes to minimize background

  • Reverse crosslinks and purify DNA for sequencing or qPCR analysis

This approach can identify potential DNA binding sites and chromatin regions associated with UPF0496 protein At3g28310/At3g28320, similar to how DEK3 binding sites were mapped genome-wide .

What protein interaction analysis methods are most effective for identifying UPF0496 binding partners?

A multi-method approach is recommended:

MethodApplicationAdvantagesLimitations
Co-immunoprecipitationIn vivo interactionsPreserves cellular contextMay lose transient interactions
Yeast two-hybridBinary interactionsHigh-throughput screeningProne to false positives
Affinity purification-mass spectrometryProtein complexesIdentifies novel partnersRequires careful controls
Proximity labeling (BioID)Spatial proximityCaptures transient interactionsRequires genetic modification

For validation, implement at least two complementary methods. Based on studies with DEK3, potential interaction partners to investigate include histones (particularly H3 and H4), components of the cohesion complex, and DNA topoisomerases .

How does UPF0496 protein At3g28310/At3g28320 contribute to chromatin regulation in Arabidopsis?

While direct evidence for UPF0496 protein At3g28310/At3g28320's role in chromatin regulation is limited, insights can be drawn from related proteins. Similar chromatin-associated proteins in Arabidopsis, such as DEK3, affect:

  • Nucleosome occupancy and positioning

  • Chromatin accessibility at specific genomic loci

  • Expression of target genes

  • Stress response pathways

To investigate these potential functions:

  • Generate knockout and overexpressor lines for UPF0496 protein At3g28310/At3g28320

  • Perform ATAC-seq to measure chromatin accessibility changes

  • Conduct RNA-seq to identify differentially expressed genes

  • Test stress tolerance under various conditions (e.g., drought, salt, heat)

What bioinformatic approaches can predict functional domains in UPF0496 protein?

A comprehensive bioinformatic pipeline should include:

  • Multiple sequence alignment with homologous proteins across species

  • Secondary structure prediction using PSIPRED or JPred

  • Tertiary structure modeling using AlphaFold or RoseTTAFold

  • Domain identification using InterPro, SMART, and Pfam

  • Phosphorylation and other post-translational modification site prediction

  • Protein-protein interaction surface prediction

This integrative approach can identify conserved domains and potential functional regions despite the "UPF" (Uncharacterized Protein Family) designation, which indicates limited functional annotation.

How does UPF0496 protein At3g28310/At3g28320 compare to other UPF0496 family members?

UPF0496 proteins constitute a family with multiple members in Arabidopsis. Comparative analysis with At4g34320 (another UPF0496 protein) reveals:

FeatureAt3g28310/At3g28320At4g34320
UniProt IDQ6E240Q9SYZ7
Length384 amino acids (full)Partial (exact length varies)
Expression systemE. coliYeast
TagHisVaries by preparation
SourceArabidopsis thalianaArabidopsis thaliana

To determine functional similarities and differences:

  • Perform phylogenetic analysis of all UPF0496 family members

  • Compare expression patterns across tissues and developmental stages

  • Analyze phenotypes of respective knockout mutants

  • Conduct complementation studies between family members

What evolutionary insights can be gained from studying UPF0496 protein conservation?

Evolutionary analysis of UPF0496 proteins can provide insights into their functional importance:

  • Identify orthologous proteins across plant species using reciprocal BLAST searches

  • Conduct selection pressure analysis (dN/dS ratio) to identify conserved functional domains

  • Compare UPF0496 protein presence/absence patterns with the evolution of specific plant traits

  • Map UPF0496 proteins onto the broader context of Arabidopsis as a model system for translational research

This evolutionary perspective can help identify functionally critical regions and guide mutagenesis studies.

How can CRISPR-Cas9 genome editing be used to study UPF0496 protein At3g28310/At3g28320 function?

A comprehensive CRISPR-Cas9 strategy includes:

  • Design multiple guide RNAs targeting different exons of At3g28310/At3g28320

  • Create complete knockout lines for loss-of-function studies

  • Introduce point mutations in predicted functional domains

  • Generate endogenously tagged versions (e.g., GFP fusion) for localization studies

  • Create conditional knockouts using inducible promoters for temporal control

Each editing strategy provides different insights:

  • Complete knockouts reveal essential functions

  • Domain-specific mutations can separate different protein functions

  • Tagged versions allow in vivo tracking without overexpression artifacts

  • Conditional systems prevent lethality if the protein is essential

What approaches help resolve contradictory data in UPF0496 protein functional studies?

When experimental results yield contradictory data:

  • Verify protein expression levels in different experimental systems

  • Test multiple genetic backgrounds to account for ecotype variation

  • Implement alternative tagging strategies (N-terminal vs. C-terminal) to rule out tag interference

  • Use complementary methodologies (in vitro, in vivo, in silico)

  • Compare results across developmental stages and environmental conditions

  • Validate antibody specificity using knockout controls

This systematic approach helps identify experimental variables contributing to discrepancies and builds a more robust understanding of protein function.

What statistical approaches are recommended for analyzing ChIP-seq data for UPF0496 proteins?

For robust ChIP-seq analysis:

  • Quality control: Filter reads with MAPQ < 30

  • Alignment: Use Bowtie2 with parameters optimized for Arabidopsis genome

  • Peak calling: Implement MACS2 with q-value < 0.01

  • Differential binding: Use DiffBind with false discovery rate < 0.05

  • Motif analysis: Apply MEME-ChIP to identify enriched sequence motifs

  • Integration: Correlate binding sites with RNA-seq data using BETA

Similar approaches were successfully used with DEK3 to map genome-wide binding sites and correlate them with gene expression changes .

How can multi-omics data integration enhance understanding of UPF0496 protein function?

A comprehensive multi-omics strategy includes:

  • Integrate ChIP-seq data (protein binding) with ATAC-seq (chromatin accessibility)

  • Correlate binding sites with RNA-seq data from knockout/overexpressor lines

  • Add proteomics data to identify interaction partners and post-translational modifications

  • Include metabolomics analysis to link to downstream cellular processes

  • Apply network analysis to place UPF0496 protein in broader cellular pathways

  • Use machine learning approaches to predict functional impacts across conditions

This integrated approach provides a systems-level understanding of protein function within the broader context of Arabidopsis biology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.