Recombinant Arabidopsis thaliana UPF0496 protein At3g48650 (At3g48650)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
At3g48650; T8P19.160; UPF0496 protein At3g48650
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-277
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At3g48650
Target Protein Sequence
MAALVEFISDRVLSSCKSACKEDPKLRSYISALRERMDKLMEIKRSPFERESRDTDFGGN NKYAGTLEKLNKVKALGDLFGDEFTTQYKAIYDEHQMLLNKSHHMQLEHEKKHKNDKKSK RLGYIFFAAALLSVLALWIYLGAVSLVVAAKVVIEVATPSIAPLWKWVTEILEDSESEIA YKKLTDLFRSMDKNANLNIEFAKTFKSLVETLLTRIKPILETVDYAVEQREEETVKLVSK KSLRILKVLLTKSRKLVQMWLGVAKWSLREELMFWNT
Uniprot No.

Target Background

Protein Families
UPF0496 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How should recombinant UPF0496 protein At3g48650 be handled and stored for optimal stability?

Proper handling and storage of recombinant UPF0496 protein At3g48650 are crucial for maintaining its stability and biological activity. Based on empirical data from manufacturers, the following protocols are recommended:

Storage ConditionRecommended ParametersMaximum Shelf Life
Long-term storage-20°C to -80°C6 months (liquid)
12 months (lyophilized)
Working aliquots4°CUp to one week

The protein is typically provided in a Tris-based buffer containing 50% glycerol, optimized for stability . This high glycerol concentration helps prevent freeze-thaw damage to the protein structure. It is critical to avoid repeated freezing and thawing, as this can lead to protein denaturation and loss of activity. Creating single-use aliquots upon initial thawing is highly recommended.

For reconstitution of lyophilized protein:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% for long-term storage

  • Create multiple small aliquots to minimize freeze-thaw cycles

These storage recommendations are based on empirical stability studies and are designed to maintain the protein's structural integrity and functional properties.

What experimental design considerations should be made when working with At3g48650?

When designing experiments involving recombinant At3g48650 protein, several methodological considerations must be addressed:

  • Experimental Controls: Include appropriate positive and negative controls specific to the experimental context. For instance, when studying protein-protein interactions, include known interacting protein pairs as positive controls and unrelated proteins as negative controls.

  • Replication Strategy: Implement a completely randomized design with a minimum of three biological replicates to ensure statistical robustness, as demonstrated in studies with related plant proteins .

  • Data Collection and Management: Record experimental data in well-organized tables with clear labels, units, and measurement uncertainties. All numerical values should maintain consistent precision (decimal places/significant digits) .

  • Protein Expression Systems: The recombinant protein is typically expressed in E. coli expression systems , but depending on the experimental needs, alternative expression systems (yeast, insect cells, plant-based) may be considered if post-translational modifications are crucial.

  • Tag Selection: Consider the impact of affinity tags (His-tag is commonly used ) on protein function, and include tag removal steps if necessary for functional assays.

  • Buffer Optimization: Optimize buffer conditions (pH, salt concentration, reducing agents) based on the protein's stability profile and the specific experimental requirements.

Implementing these considerations will help ensure reproducible and reliable results when working with At3g48650 protein.

What is known about the evolutionary relationships of UPF0496 family proteins across species?

The UPF0496 family shows interesting evolutionary patterns that can inform functional studies. While direct phylogenetic information about UPF0496 proteins is limited in the search results, we can extrapolate methodological approaches from studies of related protein families:

Research on the UPF0016 protein family demonstrates how evolutionary analysis can provide insights into protein function. A comprehensive study of UPF0016 proteins revealed that eukaryotic and cyanobacterial members share a common ancestor, reflected in their functional conservation . The researchers used maximum-likelihood methods to construct phylogenetic trees, with bootstrap values (based on 500 replicates) indicating the reliability of the branching patterns. This approach could be applied to UPF0496 proteins.

To understand the evolutionary relationships of UPF0496 proteins:

  • Retrieve protein sequences via BLAST searches using At3g48650 as a query sequence

  • Perform multiple sequence alignment of UPF0496 family members across diverse species

  • Construct phylogenetic trees using maximum-likelihood methods with appropriate outgroups

  • Calculate pairwise sequence differences and standard error estimates through bootstrap procedures

  • Identify conserved motifs that may indicate functional domains

This evolutionary approach would help identify whether UPF0496 proteins show patterns of conservation or divergence across species, potentially revealing which regions are functionally constrained and which allow for more variation.

How can researchers investigate protein-protein interactions involving UPF0496 protein At3g48650?

Investigating protein-protein interactions (PPIs) of UPF0496 protein At3g48650 requires sophisticated methodological approaches. Based on successful protocols used for other plant proteins, the following integrated strategy is recommended:

  • Affinity Chromatography-Based Proteomics:

    • Immobilize recombinant At3g48650 protein on an appropriate matrix as bait

    • Apply plant protein extracts under varying conditions (e.g., with/without stress treatments)

    • Identify interacting proteins via mass spectrometry-based protocols

    • Include proper controls to distinguish specific from non-specific interactions

  • Co-Immunoprecipitation Coupled with Mass Spectrometry:

    • Generate antibodies against At3g48650 or use tag-specific antibodies

    • Perform co-immunoprecipitation from plant extracts

    • Use liquid chromatography-mass spectrometry (LC-MS/MS) to identify co-precipitated proteins

    • Apply stringent threshold criteria for protein identification (e.g., Byonic™ scores and log probability thresholds)

  • Targeted Validation of Interactions:

    • Confirm key interactions using yeast two-hybrid assays

    • Validate in planta using bimolecular fluorescence complementation (BiFC)

    • Use FRET/FLIM for quantitative measurement of interaction dynamics

  • In silico Prediction and Network Analysis:

    • Use computational approaches to predict potential interaction partners

    • Analyze existing interaction networks to identify potential functional associations

When implementing these approaches, researchers should consider testing interactions under different physiological conditions, as the protein interaction landscape may change in response to developmental stages or stress conditions. The affinity chromatography strategies employed in search result provide a valuable framework for designing such experiments.

What methodologies can elucidate the role of At3g48650 in plant stress responses?

Given that UPF0496 proteins may be involved in stress responses, as suggested by differential expression data , the following methodological framework can be employed to characterize At3g48650's role:

  • Transcriptional Profiling:

    • Analyze At3g48650 expression across diverse stress conditions using qRT-PCR

    • Examine existing transcriptomic datasets for expression patterns

    • Develop a temporal expression profile during stress response progression

  • Genetic Modification Approaches:

    • Generate knockout/knockdown lines (T-DNA insertion, CRISPR-Cas9, RNAi)

    • Create overexpression lines under constitutive or inducible promoters

    • Perform complementation studies to confirm phenotypic observations

  • Phenotypic Characterization:

    • Evaluate growth parameters under normal and stress conditions

    • Assess physiological responses (photosynthetic efficiency, membrane integrity)

    • Measure biochemical markers (reactive oxygen species, antioxidant enzyme activities)

  • Promoter Analysis:

    • Clone the promoter region of At3g48650 into reporter constructs (such as GUS)

    • Analyze tissue-specific expression patterns under various stress conditions

    • Identify cis-regulatory elements through deletion analysis

  • Proteomic Approaches:

    • Isolate plasma membrane fractions following stress treatments

    • Identify differential protein associations using affinity-based methods

    • Analyze post-translational modifications that may regulate At3g48650 activity

A study on OsMATE genes found differential expression of At3g48650 (fold change: -2.46) in comparative transcriptomic analysis , suggesting potential involvement in stress-related pathways. This observation can serve as a starting point for more targeted investigations of At3g48650's role in specific stress response mechanisms.

How can subcellular localization of UPF0496 protein At3g48650 be determined experimentally?

Determining the subcellular localization of At3g48650 is critical for understanding its function. Multiple complementary approaches should be employed:

  • Fluorescent Protein Fusion Constructs:

    • Create N- and C-terminal GFP fusion constructs with At3g48650

    • Express in Arabidopsis protoplasts or stable transgenic lines

    • Visualize localization using confocal microscopy

    • Co-localize with established organelle markers to confirm precise location

    The cloning strategy described for subcellular localization studies of MATE transporters provides a useful template: "coding region of OsMATE1 and OsMATE2 were cloned in 326 sGFP transient expression vector between XbaI and BamHI restriction sites to encode the fusion proteins" .

  • Immunolocalization:

    • Develop antibodies against At3g48650 or use tag-specific antibodies

    • Perform immunofluorescence microscopy on fixed plant cells

    • Co-localize with organelle-specific markers

  • Biochemical Fractionation:

    • Isolate subcellular fractions (plasma membrane, chloroplasts, mitochondria, etc.)

    • Perform Western blot analysis to detect At3g48650 in specific fractions

    • Use the sucrose-density gradient centrifugation procedure for plasma membrane isolation

  • Bioinformatic Prediction and Validation:

    • Analyze the protein sequence for targeting signals (e.g., transmembrane domains)

    • Validate predictions through truncation experiments (removing potential targeting sequences)

Research on UPF0016 family proteins in Arabidopsis revealed diverse subcellular localizations including chloroplast thylakoid and inner-envelope membranes, ER, and Golgi . A similar diversity might exist for UPF0496 family proteins, making experimental verification essential.

What approaches can be used to study the potential role of At3g48650 in plant-pathogen interactions?

Given the identification of various membrane-associated proteins in plant defense responses , investigating At3g48650's potential role in this context requires sophisticated methodological approaches:

  • Pathogen Challenge Experiments:

    • Expose wild-type and At3g48650-modified plants to diverse pathogens

    • Analyze disease progression, susceptibility, and resistance markers

    • Quantify defense-related metabolites and signaling molecules

  • MAMP-Response Studies:

    • Treat plants with microbe-associated molecular patterns (MAMPs) like LPS

    • Analyze changes in At3g48650 expression, protein abundance, and localization

    • Determine whether At3g48650 interacts with known MAMP recognition components

  • Plasma Membrane-Associated Protein Analysis:

    • Implement LPS-immobilized affinity chromatography as described in search result

    • Compare the proteome profiles in response to different pathogen-derived molecules

    • Identify potential associations between At3g48650 and known defense components

  • Functional Complementation:

    • Express At3g48650 in susceptible plant lines to assess rescue of resistance

    • Perform domain-swapping experiments to identify functional regions

  • Protein-Protein Interaction Network Analysis:

    • Identify direct interactors of At3g48650 during pathogen challenge

    • Map interactions with known defense-related proteins

    • Compare interaction patterns before and after pathogen exposure

Research has shown that perception of pathogen-derived molecules like LPS likely occurs within specialized membrane microdomains, and involves various plasma membrane-associated proteins . The methodologies employed in these studies provide valuable templates for investigating At3g48650's potential role in plant immunity.

How do experimental conditions affect the stability and activity of recombinant At3g48650 protein?

Understanding the experimental conditions that affect recombinant At3g48650 stability and activity is crucial for designing valid functional assays. Based on information from recombinant protein handling protocols, the following factors should be systematically investigated:

  • Buffer Composition Effects:

    • Systematically test various buffer systems (Tris, HEPES, phosphate)

    • Optimize pH range (typically 7.0-8.0 based on storage buffer information)

    • Determine optimal salt concentration for maintaining protein solubility

  • Temperature Stability Profile:

    • Perform thermal shift assays to identify stability thresholds

    • Determine activity retention after exposure to various temperatures

    • Establish optimal temperature ranges for functional assays

  • Cryoprotectant Requirements:

    • Test various glycerol concentrations (5-50%) for optimal stability

    • Evaluate alternative cryoprotectants (sucrose, trehalose)

    • Determine minimal cryoprotectant concentrations needed for specific assays

  • Metal Ion Dependencies:

    • Investigate the effects of divalent cations (Mg²⁺, Ca²⁺, Mn²⁺)

    • Test chelating agents (EDTA, EGTA) to identify metal dependencies

    • Optimize metal ion concentrations for functional assays

  • Reducing Environment Requirements:

    • Determine the impact of reducing agents (DTT, β-mercaptoethanol)

    • Evaluate the importance of disulfide bonds for protein function

    • Establish optimal redox conditions for activity

Carefully documenting these parameters in standardized data tables with appropriate controls will help establish reproducible conditions for working with recombinant At3g48650 protein. This methodological approach ensures that observed functional characteristics reflect the protein's true biological properties rather than artifacts of experimental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.