Recombinant Arabidopsis thaliana UPF0496 protein At3g57100 (At3g57100)

Shipped with Ice Packs
In Stock

Description

Introduction

The Arabidopsis thaliana UPF0496 protein At3g57100 (At3g57100) is a protein of unknown function, characterized as part of a larger family of proteins unique to plants . These proteins often exhibit a combinatorial organization of sequence motifs, suggesting diverse roles within the plant system . Research suggests that proteins in the UPF0496 family have been recruited to serve a wide variety of functions ranging from γ-glutamyl cyclotransferase activity, to participation in plant responses to chemical and biotic stimuli .

General Information

FeatureDescription
OrganismArabidopsis thaliana (Mouse-ear cress)
Protein FamilyUPF0496
Chromosomal LocationThe distribution of the AtPCMP genes on the five chromosomes suggests that the genome of Arabidopsis thaliana contains more than 200 genes of this family (1% of the whole genome) .
CharacteristicsThe deduced AtPCMP proteins are characterized by a surprising combinatorial organization of sequence motifs . The amino-terminal domain is made of a succession of three conserved motifs which generate an important diversity . These proteins are classified into three subfamilies based on the length and nature of their carboxy-terminal domain constituted by 1-6 motifs .

Role in Plant Defense

Arabidopsis thaliana relies on its ability to recognize and respond to molecular signatures associated with pathogens . For example, LPS immune elicitation in plants is signified by a rapid influx of calcium ions into the cytoplasm as well as the production of reactive oxygen and nitrogen species (RO/NS) . In Arabidopsis thaliana, the perception of lipoglycans could possibly occur within membrane rafts/microdomains .

Involvement in Systemic Acquired Resistance (SAR)

Systemic acquired resistance (SAR) is a defense response in plants that can be triggered by local pathogen inoculation . Studies involving phosphoproteomic analysis have identified proteins with significantly altered phosphorylation levels in systemic tissues of plants following SAR induction . While At3g57100 itself is not specifically highlighted, such comprehensive analyses provide a framework for understanding the broader context of protein involvement in SAR .

Protein-Protein Interactions

Arabidopsis thaliana contains 27,416 protein-coding genes . More than 95,000 protein–protein interactions of Arabidopsis thaliana have been identified in several databases . This information can be found through a PubMed search for studies of interactions in Arabidopsis published over the last twenty years .

Future Research Directions

Further research is needed to elucidate the specific functions of At3g57100. Areas for future investigation could include:

  • Determining the protein's interactome: Identifying the proteins that At3g57100 interacts with can provide clues to its function.

  • Investigating the protein's response to various stimuli: Determining how At3g57100's expression or modification changes in response to different biotic and abiotic stresses can reveal its role in plant stress responses.

  • Examining the protein's localization: Identifying where At3g57100 is located within the cell can provide insights into its function.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
At3g57100; F24I3.180; UPF0496 protein At3g57100
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At3g57100
Target Protein Sequence
MKFCNPFLRLILRRKPISMISPTMFLLSSPTTSSSIGHSNGMLRSRSEDNLNKLGECMDN MDEDVSKLFIEFQQTDLREDPDLFRLLNHYFTTSKGVSQLCESLRTCLERSENNECLLLD EALVDFELEKLGYGGSLEEASFRKTYRDLRNFNAFYNNNSGEEDDLDYCEFLRKFQTCHE ELAKMVVKLEKTMKDIDKKLRRVRGRRAIVTAALLAPVIAVIFLSKLVAGLVPIEGLSTF VASRWRKSTESLKREKTAMSSMERGIIVALKQVEKISKLVSRLESVERSISLTAEFAVKK RSSVVVAMREVEEERKRLKSTLVDLDRETGLCNGFAQFGRTVALEKITEFLSRGDKSSK
Uniprot No.

Target Background

Database Links

KEGG: ath:AT3G57100

UniGene: At.23699

Protein Families
UPF0496 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How do researchers properly reconstitute recombinant At3g57100 protein?

When working with commercially available recombinant At3g57100 protein, proper reconstitution is critical for maintaining functionality. The recommended protocol is as follows:

  • Centrifuge the vial briefly before opening to bring contents to the bottom.

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • For long-term storage, add glycerol to a final concentration of 5-50%. The typical recommended final glycerol concentration is 50%.

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles.

  • Store aliquots at -20°C/-80°C for long-term preservation .

This reconstitution method ensures protein stability and preserves structural integrity for downstream applications.

What are the optimal conditions for high-yield soluble expression of recombinant At3g57100?

Achieving high-yield soluble expression of recombinant At3g57100 requires optimization of multiple parameters. Based on experimental design approaches similar to those used for other recombinant proteins from Arabidopsis, the following conditions are recommended:

ParameterOptimal ConditionRationale
Expression HostE. coli BL21(DE3)Commonly used for recombinant plant protein expression with good folding capability
Growth Medium5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, 1 g/L glucoseBalanced nutrition supports high cell density while controlling metabolism
Induction OD₆₀₀0.8Cells in mid-log phase have optimal protein production capacity
IPTG Concentration0.1 mMLower concentrations reduce formation of inclusion bodies
Induction Temperature25°CLower temperatures slow folding, improving soluble protein yield
Induction Duration4 hoursBalances protein yield with solubility
Antibiotic30 μg/mL kanamycinMaintains selection pressure for plasmid retention

This approach, based on factorial design methodology, has been shown to increase soluble protein yields up to 250 mg/L for similar recombinant proteins . The multivariant analysis allows for optimization of multiple variables simultaneously, which is significantly more efficient than traditional one-variable-at-a-time approaches.

What purification strategy is most effective for maintaining the structural integrity of recombinant At3g57100?

For His-tagged recombinant At3g57100, a multi-step purification strategy that preserves protein structure is recommended:

  • Initial capture using immobilized metal affinity chromatography (IMAC):

    • Use Ni-NTA resin equilibrated with buffer containing 20 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole

    • Wash with increasing imidazole concentrations (20-50 mM)

    • Elute with 250 mM imidazole

  • Polishing step using size exclusion chromatography:

    • Use a Superdex 75 or 200 column

    • Running buffer: 20 mM Tris-HCl pH 7.5, 150 mM NaCl

    • This removes aggregates and ensures monodispersity

  • Buffer exchange to final storage buffer:

    • Tris/PBS-based buffer containing 6% trehalose at pH 8.0

    • The addition of trehalose enhances protein stability during lyophilization and storage

This approach typically yields protein with greater than 90% purity as determined by SDS-PAGE, which is suitable for most research applications including structural studies and functional assays .

How can factorial design approaches improve recombinant At3g57100 expression and purification?

Factorial design is a powerful statistical approach for optimizing recombinant protein expression, particularly for proteins like At3g57100. The methodology allows researchers to:

  • Simultaneously evaluate multiple variables affecting protein expression

  • Identify statistically significant effects

  • Determine optimal conditions with fewer experiments

  • Characterize experimental error systematically

A 2^(8-4) fractional factorial design (with 8 variables tested at 2 levels) with central point replicates can be particularly effective for At3g57100 expression optimization . Key variables to include in such a design are:

VariableLow LevelHigh Level
Temperature16°C30°C
IPTG concentration0.1 mM1.0 mM
Induction time4 hours16 hours
Media compositionMinimalRich
Cell density at inductionOD₆₀₀ 0.6OD₆₀₀ 1.2
pH6.87.5
Glucose concentration0 g/L10 g/L
Antibiotic concentrationBase level2× Base level

This approach has been shown to increase soluble protein yields by up to 4-fold compared to standard conditions, while simultaneously reducing the total number of experiments required . The experimental design also allows for the identification of interaction effects between variables, which traditional one-at-a-time optimization approaches cannot detect.

What research methodologies can help determine the function of At3g57100 in Arabidopsis thaliana?

Determining the function of At3g57100 requires an integrated research approach combining multiple methodologies:

  • Genetic approaches:

    • T-DNA insertion mutants to create knockout lines

    • CRISPR-Cas9 gene editing for precise modifications

    • Overexpression lines using 35S or native promoters

    • Phenotypic characterization under various conditions (stress, developmental stages)

  • Transcriptomic analysis:

    • RNA-seq of wild-type vs. mutant plants under different conditions

    • Co-expression network analysis to identify functional relationships

    • Comparison with existing large-scale datasets such as those from the 1001 Genomes Project

  • Protein interaction studies:

    • Yeast two-hybrid screening

    • Co-immunoprecipitation followed by mass spectrometry

    • Bimolecular fluorescence complementation (BiFC) for in vivo confirmation

  • Subcellular localization:

    • GFP fusion proteins to determine compartmentalization

    • Immunolocalization with specific antibodies

    • Cell fractionation followed by Western blotting

  • Comparative genomics:

    • Analysis of UPF0496 family members across species

    • Evolutionary conservation patterns to infer functional constraints

This multifaceted approach has been successfully applied to characterize other previously unknown proteins in Arabidopsis and would be appropriate for elucidating the function of At3g57100 .

How can recombinant At3g57100 be used to study plant-pathogen interactions in Arabidopsis?

Recombinant At3g57100 can be an important tool for investigating plant-pathogen interactions in Arabidopsis. Recent research on Arabidopsis response to viral pathogens like TuMV (Turnip mosaic virus) demonstrates methodologies applicable to At3g57100 studies :

  • Protein-pathogen binding assays:

    • In vitro pull-down assays using recombinant At3g57100 and pathogen-derived proteins

    • Surface plasmon resonance to quantify binding kinetics

    • Isothermal titration calorimetry for thermodynamic characterization

  • Functional complementation studies:

    • Express recombinant At3g57100 in knockout plants to confirm phenotype rescue

    • Introduce site-directed mutations to identify critical residues for pathogen response

  • Structure-function relationship analysis:

    • Use the recombinant protein for crystallization and structural determination

    • Computational modeling to predict interaction sites with pathogen effectors

  • Genome-wide association studies (GWAS):

    • Analyze natural variation in At3g57100 across 1050+ Arabidopsis accessions

    • Correlate sequence polymorphisms with differential responses to pathogens

Recent work with TuMV has demonstrated that Arabidopsis accessions show variable susceptibility to pathogen infection, with genetic factors playing a significant role in determining response . Similar methodologies could determine if At3g57100 contributes to these differential responses.

What approaches can resolve contradictory data regarding At3g57100 function?

When confronted with contradictory data regarding At3g57100 function, researchers should implement the following systematic approach:

  • Standardize experimental conditions:

    • Establish consistent growth conditions (temperature, light, humidity)

    • Use identical genetic backgrounds for all comparisons

    • Standardize protein preparation protocols

    • Document all parameters meticulously

  • Implement factorial design to identify confounding variables:

    • Use a 2^k factorial design to systematically evaluate interaction effects

    • Include environmental variables that might influence results

    • Calculate statistical significance for all observations

  • Utilize diverse methodological approaches:

    • Combine genetic, biochemical, and computational methods

    • Verify results across multiple independent techniques

    • Consider temporal and spatial factors that might explain discrepancies

  • Cross-validate with multiple Arabidopsis accessions:

    • Test hypotheses in diverse genetic backgrounds

    • Utilize resources like recombinant inbred lines (RILs) to map genetic factors

    • Consider natural variation as a source of functional diversity

  • Employ quantitative trait loci (QTL) mapping:

    • Map phenotypes related to At3g57100 function using high-density marker data

    • Identify genetic interactions that might explain contradictory results

    • Utilize advanced genomic tools like the 16,000 single feature polymorphisms (SFPs) detected in Arabidopsis

This systematic approach has successfully resolved contradictory data for other plant proteins and should be effective for At3g57100 as well.

What structural features of At3g57100 might contribute to its function?

Although the three-dimensional structure of At3g57100 has not been experimentally determined, several structural predictions and analyses can provide insights into its potential function:

  • Sequence analysis reveals key structural elements:

    • The 359-amino acid sequence contains several conserved domains

    • Hydrophobic regions suggest possible membrane association

    • The sequence "RRAIVTAALLAPVIAVIFLSKLVAGLVPIEG" (positions 213-243) shows characteristics of a transmembrane domain

    • The C-terminal region contains potential protein-protein interaction motifs

  • Secondary structure prediction indicates:

    • Multiple alpha-helical regions, particularly in the C-terminal half

    • Beta-sheet structures primarily in the N-terminal region

    • Disordered regions that may function in protein-protein interactions

  • Conserved motifs across UPF0496 family members:

    • Alignment with other UPF0496 family proteins reveals conserved motifs that may be functionally significant

    • The sequence "LFIEFQQTDLREDPDLFRLLNHYFT" is highly conserved and may represent a functional domain

  • Post-translational modification sites:

    • Several potential phosphorylation sites throughout the sequence

    • Possible glycosylation sites that may affect protein folding and stability

These structural features provide the foundation for hypothesis generation regarding At3g57100 function and can guide experimental design for functional characterization studies.

What are the most effective protocols for identifying protein interaction partners of At3g57100?

Identifying protein interaction partners is crucial for understanding At3g57100 function. The following comprehensive protocol is recommended:

  • Yeast two-hybrid (Y2H) screening:

    • Clone full-length At3g57100 as a bait protein

    • Screen against an Arabidopsis cDNA library

    • Verify positive interactions with targeted Y2H assays

    • Consider split-ubiquitin Y2H for membrane-associated interactions

  • Co-immunoprecipitation (Co-IP) coupled with mass spectrometry:

    • Express His-tagged At3g57100 in Arabidopsis protoplasts

    • Perform Co-IP with anti-His antibodies

    • Analyze precipitated proteins by LC-MS/MS

    • Validate with reciprocal Co-IP experiments

  • In vivo confirmation using bimolecular fluorescence complementation (BiFC):

    • Fuse candidate interaction partners with split YFP halves

    • Transiently express in Nicotiana benthamiana

    • Visualize using confocal microscopy

    • Quantify fluorescence intensity to estimate interaction strength

  • Protein arrays for high-throughput screening:

    • Prepare recombinant At3g57100 protein arrays

    • Probe with plant extracts under various conditions

    • Identify binding partners using antibody detection or mass spectrometry

This multi-method approach strengthens confidence in identified interactions by validating them through independent techniques, reducing the likelihood of false positives.

How might At3g57100 be involved in plant responses to environmental stresses?

While the specific role of At3g57100 in stress responses has not been fully characterized, research methodologies used to study similar proteins in Arabidopsis can be applied:

  • Expression analysis under various stresses:

    • qRT-PCR to measure At3g57100 expression under drought, salinity, temperature stress, and pathogen infection

    • RNA-seq for genome-wide expression changes in wild-type vs. At3g57100 mutants

    • Promoter-GUS fusion to visualize tissue-specific expression patterns under stress

  • Phenotypic characterization of mutant lines:

    • T-DNA insertion lines or CRISPR knockouts of At3g57100

    • Overexpression lines under native or constitutive promoters

    • Stress tolerance assays measuring survival, growth, and physiological parameters

  • Comparison with known stress response pathways:

    • Monitor canonical stress markers in At3g57100 mutants

    • Analyze hormone levels (ABA, JA, SA, ethylene) in response to stress

    • Epistasis analysis with known stress response genes

Research on plant-pathogen interactions, particularly with viruses like TuMV, has demonstrated that genetic factors in Arabidopsis contribute significantly to stress responses . Similar approaches could determine if At3g57100 plays a role in these responses, particularly given the presence of potential regulatory domains in its sequence.

How can genome-wide association studies (GWAS) help understand At3g57100 function?

GWAS approaches can provide valuable insights into At3g57100 function by:

  • Analyzing natural variation across Arabidopsis accessions:

    • Genotype data from 1050+ Arabidopsis accessions can be correlated with phenotypic variation

    • Single nucleotide polymorphisms (SNPs) in At3g57100 can be associated with specific traits

    • This approach has successfully identified genetic associations with responses to viral infection

  • Identifying functional networks:

    • Genes that show similar association patterns may function in the same pathways

    • Co-expression networks based on RNA-seq data can complement GWAS results

    • Epistatic interactions can be detected through advanced statistical models

  • Linking structural variants to phenotypes:

    • Beyond SNPs, structural variants in the At3g57100 locus can be analyzed

    • Recent approaches using low-coverage sequencing have identified 6502 segregating structural variants in Arabidopsis

    • These structural variants have been linked to specific quantitative trait loci for traits like germination time and pathogen resistance

  • Methodology for GWAS implementation:

    • Phenotype a large panel of Arabidopsis accessions (>1000) under relevant conditions

    • Use high-density genotyping data (>250,000 SNPs)

    • Apply mixed linear models to account for population structure

    • Validate significant associations with functional studies in knockout/overexpression lines

This approach has been used successfully to identify genetic associations with response to pathogens like TuMV in Arabidopsis , providing a framework for similar studies with At3g57100.

How should researchers design a comprehensive research program to characterize At3g57100?

A comprehensive research strategy for At3g57100 characterization should include:

  • Phase 1: Preliminary characterization (0-6 months)

    • Subcellular localization using GFP fusion proteins

    • Expression profiling across tissues and developmental stages

    • Phylogenetic analysis and comparison with characterized homologs

    • Generation of knockout and overexpression lines

  • Phase 2: Functional analysis (6-18 months)

    • Phenotypic characterization of mutant lines under normal and stress conditions

    • Transcriptomic analysis (RNA-seq) of wild-type vs. mutant plants

    • Protein interaction studies using Y2H and Co-IP/MS

    • Metabolomic profiling to identify affected pathways

  • Phase 3: Mechanistic studies (18-36 months)

    • Structural characterization of recombinant At3g57100

    • Site-directed mutagenesis of key residues

    • ChIP-seq to identify potential DNA binding sites (if relevant)

    • Mathematical modeling of affected pathways

  • Phase 4: Integration and application (36+ months)

    • Systems biology approach to integrate all data

    • Potential biotechnological applications based on findings

    • Translation to crop species if beneficial traits are identified

This phased approach ensures logical progression from basic characterization to detailed mechanistic understanding and potential applications.

What are the most rigorous methods for formulating research questions about At3g57100?

Formulating rigorous research questions about At3g57100 requires a systematic approach:

  • Criteria for strong research questions:

    • Questions should be focused on a single problem or issue

    • Must be researchable using primary/secondary sources

    • Should be feasible within practical constraints

    • Must be specific enough to answer thoroughly

    • Should be complex enough to develop over a paper or thesis

    • Must be relevant to the field and broader scientific community

  • Research question development process:

    • Begin with preliminary literature review to identify knowledge gaps

    • Narrow focus to specific aspects of At3g57100 function

    • Identify the specific research problem to address

    • Frame questions based on research objectives (descriptive, explanatory, or evaluative)

  • Evaluate question strength using established criteria:

    • Is the question focused and researchable?

    • Is it feasible and specific?

    • Is it complex and arguable?

    • Is it relevant and original?

  • Examples of strong research questions about At3g57100:

    • "What role does At3g57100 play in Arabidopsis thaliana response to drought stress?"

    • "How do structural features of At3g57100 contribute to its function in cellular signaling pathways?"

    • "What are the key protein interaction partners of At3g57100 during different developmental stages?"

This methodological approach to question formulation ensures that research on At3g57100 is rigorous, focused, and contributes meaningfully to the field.

What are the most promising future research directions for At3g57100?

Based on current knowledge and research methodologies, the most promising future research directions for At3g57100 include:

  • Structural biology approaches:

    • X-ray crystallography or cryo-EM to determine the 3D structure

    • NMR studies to analyze dynamic properties and binding interactions

    • Computational modeling to predict functional domains and interaction surfaces

  • Systems biology integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Network analysis to position At3g57100 within cellular pathways

    • Mathematical modeling to predict system-level effects of At3g57100 perturbation

  • Translational research:

    • Identification of homologs in crop species

    • Functional conservation studies across plant species

    • Potential biotechnological applications based on At3g57100 function

  • Environmental adaptation studies:

    • Role of At3g57100 in adaptation to changing environments

    • Natural variation analysis across ecological gradients

    • Contribution to local adaptation and speciation events

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.