Recombinant Arabidopsis thaliana UPF0496 protein At4g34330 (At4g34330)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
At4g34330; F10M10.100; UPF0496 protein At4g34330
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At4g34330
Target Protein Sequence
MGNKTSRKSKEKSGRNYTTELRSYEAACKEDMEIQSFDTRMQARTSHVISTLATGVEVRS LSFDSLKAVIGSLLDMNQEVAKVILDCKKDIWKNQEMFEFVEAYFETSLKTLDFFNALKR GLQGVQINHLFILDGNGYKKTLQELKRFKDADRPFDQDFFKMFQSVYNQQKWMLDKLQRR QNKLDKKLKRIRTWRKLSSIIFMATFATLVICSVLAATMAAPHVAAALAAATPPVGSMGK WIDSLWKNYENEIKGQTEVFSSMYVGTYVAVQDLNNIKDLIKRLDTEIRGMVKNAEYAGE LGPVKIGINAIKTQLEVFKKNVEELEIQADMCSTDIRRARTVILQRIINATCST
Uniprot No.

Target Background

Database Links
Protein Families
UPF0496 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is At4g34330 and what are its basic structural characteristics?

At4g34330 is a UPF0496 family protein found in Arabidopsis thaliana (Mouse-ear cress). The full-length protein consists of 354 amino acids and belongs to the UPF0496 protein family, a group of proteins with currently unknown function. The protein is encoded by a gene located on chromosome 4 of the Arabidopsis genome. Recombinant versions of this protein are typically produced with tags (such as His-tag) to facilitate purification and detection in experimental systems .

How is the recombinant At4g34330 protein typically produced?

Recombinant At4g34330 can be produced in different expression systems. The protein is commonly expressed in E. coli bacterial systems for full-length production with His-tags for purification purposes . Alternative expression in yeast systems is also utilized for producing partial protein constructs with high purity (>85% as determined by SDS-PAGE) . The choice of expression system depends on experimental requirements, with bacterial systems offering higher yield while yeast may provide better post-translational modifications for functional studies.

What are the optimal storage and handling conditions for recombinant At4g34330?

For optimal preservation of recombinant At4g34330, the protein should be stored according to the following guidelines:

Storage FormTemperatureRecommended Shelf Life
Liquid form−20°C/−80°C6 months
Lyophilized form−20°C/−80°C12 months
Working aliquots4°CUp to one week

For reconstitution, the protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of glycerol to a final concentration of 5-50% (typically 50%) is recommended for long-term storage. Repeated freeze-thaw cycles should be avoided to maintain protein integrity .

What methods are effective for analyzing At4g34330 in membrane fractions?

For effective analysis of At4g34330 in membrane fractions, a specialized proteomic approach is recommended. Standard two-dimensional gel electrophoresis often resolves membrane proteins poorly. Instead, researchers should:

  • Prepare subcellular fractions enriched in the target membrane type

  • Wash with appropriate agents to remove peripheral and contaminating proteins

  • Subject remaining membrane-bound proteins to SDS-PAGE

  • Perform in-gel digestion with appropriate proteases (such as lysylendopeptidase)

  • Separate resulting peptides by reverse-phase HPLC

  • Identify proteins through sequencing techniques such as Edman degradation

This approach has proven effective for identifying membrane-bound proteins in Arabidopsis thaliana, including transporters, channels, receptors, and proteins with unknown functions .

How can I design experiments to investigate At4g34330 functional interactions?

Designing experiments to investigate At4g34330 functional interactions requires multiple complementary approaches:

  • Protein-Protein Interaction Studies: Employ yeast two-hybrid, co-immunoprecipitation, or pull-down assays to identify direct protein interactions.

  • Genetic Approaches: Use STAIRS (STepped Aligned Recombinant Inbred Strains) or chromosome substitution lines to investigate the genetic context and potential epistatic interactions.

  • Expression Analysis: Implement microarray gene expression profiling to compare gene expression patterns between wild-type and At4g34330 mutant lines at both chronological and physiological equivalent developmental stages.

  • Functional Complementation: Perform rescue experiments with the recombinant protein in knockout/knockdown lines to verify functional roles.

These approaches should be designed with appropriate controls and replications to ensure statistical validity and reproducibility of results .

How can QTL mapping approaches be applied to understand the genetic context of At4g34330?

QTL mapping can provide valuable insights into the genetic context of At4g34330 through:

  • Development of Specialized Genetic Resources: Create narrow STAIRS (STepped Aligned Recombinant Inbred Strains) covering the region containing At4g34330 on chromosome 4 using marker-assisted backcross breeding programs.

  • High-Resolution Mapping: Saturate the region with polymorphic microsatellite markers to achieve fine mapping resolution (potentially 2-3 cM or better).

  • Phenotypic Analysis: Score multiple potentially related morphological traits, including flowering time, leaf development, and growth characteristics.

  • Correlation Analysis: Perform Pearson's correlation coefficient analysis between traits to identify pleiotropic effects.

  • Candidate Gene Analysis: Compare mapped QTL positions with the known location of At4g34330 to determine if it potentially underlies observed phenotypic variation.

This systematic approach allows researchers to determine whether At4g34330 contributes to quantitative trait variation and identify its potential functional relationships with other genetic loci .

What role might At4g34330 play in developmental processes based on current research?

While specific developmental functions of At4g34330 are not explicitly detailed in the provided literature, research approaches used for related proteins can guide investigation:

  • Expression Pattern Analysis: Microarray gene expression profiling at different developmental stages and in various tissues can reveal temporal and spatial patterns of At4g34330 expression.

  • Correlative Phenotypic Studies: QTL analysis of traits like flowering time, leaf number at day 20, and rosette and cauline leaf numbers at flowering may reveal correlations with At4g34330 expression or genetic variation.

  • Comparative Analysis: Examine expression patterns in specific developmental contexts, comparing both chronological and physiological ages of different genotypes.

By integrating these approaches, researchers can begin to establish potential developmental roles for At4g34330, particularly if it functions in pathways related to flowering time regulation or leaf development, both extensively studied in Arabidopsis thaliana .

How can proteomic approaches enhance our understanding of At4g34330 function?

Proteomic approaches provide critical insights into At4g34330 function through:

  • Subcellular Localization: Prepare fractions enriched in specific cellular compartments (vacuolar membranes, plasma membrane, etc.) to determine where At4g34330 predominantly localizes.

  • Post-translational Modification Analysis: Identify potential phosphorylation, glycosylation, or other modifications that might regulate At4g34330 activity.

  • Identification of Interacting Partners: After SDS-PAGE separation and protein digestion with appropriate enzymes like lysylendopeptidase, analyze peptides by reverse-phase HPLC coupled with sequencing to identify proteins co-purifying with At4g34330.

  • Comparative Proteomics: Compare protein abundance and modifications between wild-type and mutant plants or under different environmental conditions.

This systematic proteomic approach can effectively identify whether At4g34330 functions as a transmembrane protein (like transporters, channels, or receptors) or as a membrane-anchored protein through hydrophobic anchors or association with other membrane-bound proteins .

What are common challenges in working with recombinant At4g34330 and how can they be addressed?

Researchers commonly encounter several challenges when working with recombinant At4g34330:

ChallengePotential Solutions
Poor protein solubilityOptimize buffer conditions; consider detergents for membrane proteins; test different tags; adjust expression temperature
Limited stabilityAdd glycerol (5-50%) to storage buffer; store in small aliquots; avoid repeated freeze-thaw cycles
Low expression yieldsOptimize codon usage; test different expression systems (E. coli vs. yeast); adjust induction conditions
Protein misfoldingExpress protein with chaperones; use slower expression rates at lower temperatures; test insect or mammalian expression systems
Purification difficultiesOptimize purification protocols; use tandem affinity tags; implement multi-step purification strategies

Addressing these challenges requires systematic optimization of expression, purification, and storage conditions specific to At4g34330's properties .

How should researchers interpret contradictory findings about At4g34330 function?

When faced with contradictory findings regarding At4g34330 function, researchers should:

  • Evaluate Methodological Differences: Compare experimental approaches, expression systems, tags used, and assay conditions that might explain discrepancies.

  • Consider Genetic Background Effects: Assess whether experiments were conducted in different Arabidopsis ecotypes (Columbia vs. Landsberg), as genetic background can significantly influence protein function.

  • Analyze Context Dependency: Determine if environmental conditions, developmental stages, or tissue-specific factors differ between studies.

  • Implement Complementary Approaches: Combine genetic, biochemical, and cellular approaches to build a more comprehensive understanding of At4g34330 function.

  • Perform Meta-analysis: Systematically review all available data to identify patterns and potential explanations for contradictory results.

This structured approach helps resolve apparent contradictions and may reveal conditional or context-dependent functions of At4g34330 .

What statistical approaches are appropriate for analyzing At4g34330 expression data?

For robust analysis of At4g34330 expression data, researchers should implement:

  • Analysis of Variance (ANOVA): To assess significant differences in expression levels across different conditions, genotypes, or developmental stages.

  • Least Squares Model Fitting: To model expression patterns and identify significant parameters influencing At4g34330 expression.

  • Pearson's Correlation Coefficients: To identify genes with expression patterns correlated with At4g34330, potentially revealing functional relationships.

  • Multiple Testing Correction: Apply methods like Bonferroni or False Discovery Rate (FDR) correction when performing genome-wide comparisons.

  • Principal Component Analysis: To identify major patterns of variation in expression data across multiple conditions.

These statistical approaches ensure rigorous interpretation of expression data, particularly when comparing differential expression at both chronological and physiological equivalent developmental stages .

What are promising approaches to elucidating the function of At4g34330?

Several promising approaches can advance understanding of At4g34330 function:

  • CRISPR/Cas9 Gene Editing: Generate precise mutations or knockouts of At4g34330 to assess phenotypic consequences.

  • Conditional Expression Systems: Develop inducible expression lines to study temporal aspects of At4g34330 function.

  • Domain-Specific Mutational Analysis: Create targeted mutations in specific protein domains to dissect structure-function relationships.

  • Interactome Mapping: Perform systematic protein-protein interaction studies to place At4g34330 in cellular networks.

  • Comparative Genomics: Analyze homologs across plant species to identify conserved functions and evolutionary significance.

These approaches, particularly when combined, offer powerful strategies for elucidating the biological functions of this currently uncharacterized UPF0496 family protein .

How might At4g34330 be involved in plant stress responses or environmental adaptation?

Investigation of At4g34330's potential role in stress responses should include:

  • Expression Analysis Under Stress Conditions: Monitor expression patterns under various abiotic stresses (drought, salt, temperature) and biotic challenges.

  • Phenotypic Assessment of Mutant Lines: Compare stress tolerance phenotypes between wild-type and At4g34330 mutant plants.

  • Subcellular Relocalization Studies: Determine if stress conditions alter cellular localization of the protein.

  • Genetic Interaction Analysis: Test for genetic interactions with known stress response pathways through double mutant analysis.

  • Comparative Analysis Across Ecotypes: Examine potential natural variation in At4g34330 sequence and expression across Arabidopsis ecotypes adapted to different environments.

These research directions may reveal whether At4g34330 contributes to plant adaptation to environmental challenges, a critical aspect of plant biology with potential applications in crop improvement .

What technologies on the horizon might accelerate research on At4g34330?

Emerging technologies that could accelerate At4g34330 research include:

  • Single-Cell Proteomics: To determine cell-type specific expression and interactions of At4g34330.

  • Cryo-EM Structural Analysis: To elucidate the three-dimensional structure of At4g34330 and its potential interaction interfaces.

  • Plant Cell Atlas Initiatives: To place At4g34330 in a comprehensive map of cellular components and interactions.

  • Machine Learning Approaches: To predict protein function based on sequence features and interaction networks.

  • Synthetic Biology Tools: To reconstruct and test hypothesized pathways involving At4g34330 in simplified systems.

These cutting-edge approaches could overcome current limitations in understanding this uncharacterized protein and reveal its position in plant cellular networks and physiological processes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.