Recombinant Arabidopsis thaliana UPF0496 protein At5g66660 (At5g66660)

Shipped with Ice Packs
In Stock

Description

Production and Expression Systems

Recombinant At5g66660 is produced using diverse platforms, including:

  • Cell-Free Systems: Utilized for high-throughput expression, enabling precise control over reaction conditions .

  • Escherichia coli: Employed by some manufacturers, though purity and solubility may vary .

  • Arabidopsis-Based Systems: While not directly reported for At5g66660, Arabidopsis is increasingly used for homologous protein production due to its capacity for native post-translational modifications .

Table 2: Production Parameters and Purity

ParameterSpecificationSource
Purity≥85% (SDS-PAGE validated)
Host SystemCell-free or E. coli
Storage BufferTris-based, 50% glycerol, optimized pH

Functional Insights and Research Applications

Despite its conserved sequence, the biological function of At5g66660 remains unclear. Key observations include:

  • UPF0496 Family: Members of this family are annotated as "uncharacterized," suggesting potential roles in novel pathways or regulatory processes .

  • Transmembrane Architecture: Its multi-pass structure implies involvement in membrane-bound processes, such as ion transport or signaling .

Research Applications:

  • Biochemical Assays: Recombinant At5g66660 is used to study protein-protein interactions, enzymatic activity (if any), or structural biology (e.g., X-ray crystallography).

  • Control Experiments: Serves as a reference in studies involving transmembrane proteins or UPF0496 homologs.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
At5g66660; MSN2.4; UPF0496 protein At5g66660
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-398
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At5g66660
Target Protein Sequence
MEFCGCLSELMNGESSSKRNGPSTLPVKEVRTDMRSKYSSDLSSYTSACKKDSNLKSFDS SLHQRTNIIITSLAARAETQSLNLDSLMEVYGFLLELNQNAVRVIIESREDVWKNKDLKS LVDVYFKSTSKTLDFCNTVENCVKRTEISQLIIRFAVKQFEAESVDTDLGGDKKKKKYTK TLEELNKFKAMGDPFDGELVTQFDSVYDQQVLFLEELRKQRRKLDKKQRNVKTLRTVSNV FFATAYVSVLVLSVVATTMSAPPVVCAVASGSTAPIEITGKWFSQMWKKYEKAVKRQRGL VLTMESRVQVNNEAMKNIRSDVDELRSWVSSILETVDFAVEREEEEEAMGLAMQGIKKHV DGFTEKMEEVGENAAKCSKFIALGRLLVLEHILGLPAN
Uniprot No.

Target Background

Database Links

KEGG: ath:AT5G66660

STRING: 3702.AT5G66660.1

UniGene: At.65708

Protein Families
UPF0496 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the function of UPF0496 protein At5g66660 in Arabidopsis thaliana?

UPF0496 protein At5g66660 in Arabidopsis thaliana is part of an uncharacterized protein family with potential roles in DNA repair mechanisms. While its specific function remains under investigation, structural analysis suggests it contains domains similar to those found in proteins involved in recombinational DNA repair processes. The protein may play a role in the plant's stress response system, particularly in relation to oxidative damage repair pathways similar to those observed in SNM-dependent processes . Researchers should approach functional characterization through multiple complementary methods including:

  • Phenotypic analysis of knockout/knockdown mutants

  • Expression pattern studies under various stress conditions

  • Protein-protein interaction assays to identify binding partners

  • Subcellular localization studies to determine cellular compartmentalization

How can I successfully express recombinant At5g66660 protein in a bacterial system?

For optimal expression of recombinant At5g66660 protein in bacterial systems, researchers should consider the following methodological approach:

  • Codon optimization for E. coli expression

  • Selection of an appropriate expression vector (pET series vectors often work well)

  • Inclusion of appropriate purification tags (His-tag or GST-tag)

  • Expression temperature optimization (typically lower temperatures of 16-22°C improve solubility)

  • Testing multiple bacterial strains (BL21(DE3), Rosetta, or Origami for proteins with disulfide bonds)

Expression trials should include testing induction conditions at various IPTG concentrations (0.1-1.0 mM) and temperatures. For proteins similar to At5g66660 with potential DNA-binding properties, addition of 1-5% glucose in the medium may help reduce basal expression and toxicity issues that can arise with DNA-interacting proteins.

What are the best methods for purifying recombinant At5g66660 protein?

Purification of recombinant At5g66660 protein can be achieved through a multi-step process similar to that used for SNM-related proteins in Arabidopsis :

  • Initial capture using affinity chromatography (Ni-NTA for His-tagged protein)

  • Intermediate purification using ion exchange chromatography

  • Final polishing step with size exclusion chromatography

Recommended buffer conditions:

  • Lysis buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 5% glycerol, 1 mM DTT

  • Washing buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 20 mM imidazole

  • Elution buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 250 mM imidazole

The addition of protease inhibitors (PMSF, leupeptin, pepstatin) in the lysis buffer is critical. For proteins involved in DNA repair mechanisms, maintaining reducing conditions throughout purification is important to preserve activity.

How can I investigate potential roles of At5g66660 in DNA repair mechanisms?

To investigate At5g66660's potential involvement in DNA repair mechanisms, implement a comprehensive approach similar to that used for studying AtSNM1 :

  • Generate knockout/knockdown lines using T-DNA insertion or CRISPR-Cas9

  • Subject these lines to DNA-damaging agents including:

    • H₂O₂ for oxidative stress (0.6-1.2 mM range)

    • Bleomycin for double-strand breaks

    • UV radiation for photodamage

    • Mitomycin C or cisplatin for interstrand crosslinks

  • Quantify repair efficiency using in vitro DNA repair assays with cell extracts from wild-type and mutant plants

  • Monitor homologous recombination frequency with appropriate recombination substrates

  • Assess protein localization during DNA damage using fluorescent fusion proteins

Analysis of the At5g66660 mutant response to oxidative stress is particularly important given that SNM-related proteins in Arabidopsis show hypersensitivity to H₂O₂ and bleomycin but not necessarily to interstrand crosslinking agents . This pattern differs from yeast and mammalian homologs, suggesting potentially unique roles for these proteins in plant DNA repair.

What approaches can I use to study At5g66660 protein interactions within repair pathways?

To elucidate At5g66660 protein interactions within repair pathways, employ these methodological strategies:

  • Yeast two-hybrid screening:

    • Use full-length At5g66660 and domain-specific constructs as bait

    • Screen against Arabidopsis cDNA libraries derived from tissues under oxidative stress

  • Co-immunoprecipitation coupled with mass spectrometry:

    • Express tagged versions of At5g66660 in Arabidopsis

    • Induce DNA damage with H₂O₂ or bleomycin prior to protein extraction

    • Identify interacting partners through MS/MS analysis

  • Bimolecular Fluorescence Complementation (BiFC):

    • Confirm interactions in planta

    • Visualize subcellular localization of interaction complexes

  • Chromatin Immunoprecipitation (ChIP):

    • Identify genomic regions where At5g66660 might function

    • Map binding patterns before and after DNA damage

The experimental design should include both normal conditions and oxidative stress treatments, as SNM-related proteins show specific involvement in recombinational repair following oxidative damage .

How does genetic background influence At5g66660 function in different Arabidopsis accessions?

To investigate the influence of genetic background on At5g66660 function across Arabidopsis accessions:

  • Sequence and compare At5g66660 alleles from diverse accessions (Col-0, Van-0, Ler, etc.)

  • Generate reciprocal crosses between accessions with different At5g66660 alleles

  • Create advanced intercross recombinant inbred lines (RILs) from these crosses

  • Phenotype these lines for DNA repair efficiency and oxidative stress response

  • Perform QTL mapping to identify genetic modifiers that interact with At5g66660

This approach leverages the natural variation in Arabidopsis to understand how At5g66660 function may be modulated by other genetic factors. Based on similar studies with DNA repair genes, you may observe accession-specific differences in repair efficiency and stress tolerance . The advanced intercross RIL population provides higher mapping resolution than conventional RILs due to increased recombination events.

What is the role of At5g66660 in somatic homologous recombination during oxidative stress?

To investigate At5g66660's role in somatic homologous recombination during oxidative stress:

  • Cross At5g66660 knockout/knockdown lines with Arabidopsis lines containing homologous recombination substrates (such as the IC9 or 1406 lines)

  • Subject these plants to oxidative stress inducers:

    • H₂O₂ treatments (0.6-1.2 mM)

    • Bacterial elicitors like flagellin peptide FLG22

    • Bleomycin treatments

  • Measure recombination frequency using histochemical GUS assay 4 days after treatment

  • Compare recombination frequencies between wild-type and At5g66660 mutant plants

Based on studies of SNM1-dependent repair in Arabidopsis, you may expect At5g66660 mutants to show altered homologous recombination frequency following oxidative stress if the protein functions in similar pathways . The somatic homologous recombination frequency (HRF) can be quantified as the total number of GUS-positive spots per total number of plants, providing a direct measure of recombination events.

How should I design gene expression studies to examine At5g66660 responses to various stresses?

For comprehensive gene expression analysis of At5g66660 responses to stress:

  • Stress treatments design:

    • Oxidative stress: H₂O₂ (0.6, 1.2, 2.4 mM), paraquat (1, 5, 10 μM)

    • DNA damage: bleomycin (1, 5, 10 μg/ml), UV-C (50, 100, 200 J/m²)

    • Biotic stress: bacterial elicitors (FLG22, 100 nM)

    • Abiotic stress: salt, drought, heat, cold

  • Time-course sampling:

    • Early response: 1, 3, 6 hours post-treatment

    • Late response: 12, 24, 48 hours post-treatment

  • Tissue-specific analysis:

    • Roots, leaves, stems, flowers, and developing siliques

  • Expression quantification methods:

    • RT-qPCR for targeted analysis

    • RNA-Seq for genome-wide expression patterns

    • Use at least three reference genes for normalization (ACT2, UBQ10, EF1α)

When analyzing SNM-related genes in Arabidopsis, significant expression changes are typically observed within 3-6 hours after oxidative stress treatments . Include appropriate controls using inactive peptides (such as the inactive flagellin derivative that differs by 1 amino acid) alongside active elicitors .

What are the best approaches to resolve contradictory phenotypic data in At5g66660 mutants?

When facing contradictory phenotypic data in At5g66660 mutants:

  • Verify mutant lines:

    • Confirm T-DNA insertion positions by PCR and sequencing

    • Quantify transcript and protein levels by RT-qPCR and Western blot

    • Generate multiple independent mutant lines (T-DNA, CRISPR, RNAi)

  • Control for genetic background effects:

    • Backcross mutants to wild-type at least three times

    • Generate complementation lines expressing At5g66660 under native promoter

    • Create multiple independent transgenic lines to control for position effects

  • Standardize experimental conditions:

    • Control growth conditions (light, temperature, humidity, soil composition)

    • Synchronize plant developmental stages

    • Perform experiments with adequate biological replicates (n≥30)

  • Resolve tissue-specific differences:

    • Conduct tissue-specific expression studies

    • Generate tissue-specific complementation lines

In cases where contradictions persist, consider the possibility of genetic redundancy. The Arabidopsis genome contains multiple SNM-like proteins sharing 32-36% identity that may have partially overlapping functions . Testing double or triple mutants may be necessary to observe clear phenotypes.

How can I determine if At5g66660 functions in both mitotic and meiotic recombination?

To investigate At5g66660's potential dual role in mitotic and meiotic recombination:

  • For mitotic recombination analysis:

    • Use somatic recombination reporter lines (such as GUS-based reporters)

    • Subject plants to DNA-damaging agents

    • Quantify recombination events in somatic tissues

  • For meiotic recombination analysis:

    • Analyze tetrad formation and pollen viability

    • Measure crossover frequency using fluorescent markers

    • Examine chromosome pairing during meiosis I by FISH

    • Quantify seed set as an indicator of successful meiosis

  • Comparative approach:

    • Generate plants expressing tissue-specific RNAi constructs targeting At5g66660

    • Create constructs under meiotic-specific promoters (e.g., DMC1) and somatic-specific promoters

  • Cytological studies:

    • Immunolocalize At5g66660 during various stages of meiosis

    • Co-localize with known meiotic recombination markers (DMC1, RAD51)

Analysis of female-mediated nonrandom mating, as revealed in advanced intercross RIL populations, may provide additional insight into potential meiotic functions . Quantitative trait loci (QTLs) associated with female-mediated nonrandom mating could interact with or include At5g66660.

What are the optimal growth conditions for phenotyping At5g66660 mutants?

For optimal and consistent phenotyping of At5g66660 mutants:

Standard growth conditions:

  • Temperature: 20-22°C day/16-18°C night

  • Photoperiod: 16h light/8h dark for vegetative growth; 12h light/12h dark for synchronized flowering

  • Light intensity: 120-150 μmol m⁻² s⁻¹

  • Humidity: 60-70%

  • Growth media: MS salts, 1% sucrose, 0.8% agar, pH 5.8 for in vitro studies

  • Soil: 2:1:1 mix of soil:vermiculite:perlite for pot-grown plants

Stress treatment parameters for DNA repair studies:

  • H₂O₂: 0.6-1.2 mM applied by spraying or medium supplementation

  • Bleomycin: 0.5-1.5 μg/ml in liquid medium

  • UV-C: 1000-3000 J/m²

  • MMC: 5-20 μg/ml

  • Cisplatin: 5-30 μM

Phenotyping should be performed across multiple developmental stages, with particular attention to the timing of stress application. For DNA repair studies, treatments are typically most effective when applied to 2-week-old seedlings, with phenotypic evaluation 4-7 days post-treatment .

What controls should be included when studying At5g66660 involvement in DNA repair pathways?

When investigating At5g66660's role in DNA repair, include these essential controls:

  • Genetic controls:

    • Wild-type (same ecotype background as mutants)

    • Known DNA repair mutants (positive controls):

      • atm-1 or atr mutants for DNA damage signaling

      • rad51 mutants for homologous recombination

      • ku70/ku80 mutants for non-homologous end joining

    • Complementation lines expressing At5g66660 under native promoter

  • Treatment controls:

    • Untreated plants of each genotype

    • Mock treatments (buffer only)

    • Dose response series for each DNA-damaging agent

    • Inactive peptide controls for elicitor treatments

  • Analytical controls:

    • For protein expression: loading controls (actin, tubulin)

    • For gene expression: multiple reference genes (ACT2, UBQ10, EF1α)

    • For recombination assays: lines with known recombination frequencies

  • Temporal controls:

    • Synchronize plant age and developmental stage

    • Consistent timing for treatments and analyses

Include known SNM family mutants as comparative controls since there are three SNM-like proteins in Arabidopsis that share 32-36% identity and may have overlapping functions .

How can I accurately quantify At5g66660 protein levels in different subcellular compartments?

To accurately quantify At5g66660 protein levels across subcellular compartments:

  • Subcellular fractionation approach:

    • Isolate nuclear, cytoplasmic, and organellar fractions

    • Verify fraction purity using compartment-specific markers:

      • Nuclear: Histone H3

      • Cytoplasmic: GAPDH

      • Chloroplast: RbcL

      • Mitochondrial: COX2

    • Perform Western blot with specific anti-At5g66660 antibodies

    • Quantify band intensity using appropriate software (ImageJ)

  • Fluorescent protein fusion approach:

    • Generate N- and C-terminal GFP/YFP fusions

    • Confirm functionality through complementation

    • Visualize localization by confocal microscopy

    • Quantify fluorescence intensity across compartments

  • Immunofluorescence microscopy:

    • Fix and permeabilize tissues

    • Use specific antibodies against At5g66660

    • Co-stain with organelle markers

    • Perform Z-stack imaging and 3D reconstruction

  • Dynamics study:

    • Track protein redistribution after stress treatments

    • Perform time-course analyses (0, 15, 30, 60, 120 min)

Since SNM-related proteins may relocalize in response to DNA damage, quantification should be performed both before and after treatments with DNA-damaging agents. For accurate quantification, normalize At5g66660 levels to compartment-specific markers rather than total protein content.

How should I analyze the relationship between At5g66660 expression levels and stress response phenotypes?

To robustly analyze the relationship between At5g66660 expression and stress responses:

  • Correlation analysis framework:

    • Measure At5g66660 transcript levels by RT-qPCR across treatments

    • Quantify corresponding phenotypes (survival rate, growth parameters)

    • Calculate Pearson's or Spearman's correlation coefficients

    • Generate scatter plots with regression lines

  • Expression level categorization:

    • Group plants by expression quartiles (low, medium-low, medium-high, high)

    • Compare phenotypic distributions among groups

    • Perform ANOVA with post-hoc tests

  • Time-series analysis:

    • Track expression changes and phenotypic responses over time

    • Calculate time-lagged correlations to identify cause-effect relationships

    • Use dynamic models to capture expression-phenotype relationships

  • Genetic approach:

    • Generate plants with various levels of At5g66660 expression:

      • RNAi lines with partial knockdown

      • Overexpression lines with varying expression levels

      • Native promoter with different strength alleles

    • Correlate expression levels with quantitative phenotypes

For DNA repair genes, there is often a non-linear relationship between expression and function, with both under-expression and over-expression potentially leading to impaired repair capacity. This pattern has been observed with SNM-related proteins in Arabidopsis .

What statistical approaches are most appropriate for analyzing At5g66660 phenotypic data?

When analyzing phenotypic data for At5g66660 mutants:

  • For continuous phenotypic variables (growth measurements, recombination frequencies):

    • Two-sample comparisons: Student's t-test (parametric) or Mann-Whitney U test (non-parametric)

    • Multiple comparisons: ANOVA with Tukey's or Bonferroni post-hoc tests

    • Repeated measures: RM-ANOVA or linear mixed models

  • For survival/categorical data:

    • Chi-square tests for frequency comparisons

    • Logistic regression for predicting binary outcomes

    • Kaplan-Meier survival analysis with log-rank tests

  • For QTL mapping (relevant for studying At5g66660 in different genetic backgrounds):

    • Composite interval mapping as used in female-mediated nonrandom mating studies

    • Multiple QTL mapping to identify interacting loci

    • Bayesian approaches for complex trait architecture

  • Sample size and power considerations:

    • Minimum sample sizes for recombination studies: 24-48 plants per replicate

    • Experiments should be performed in triplicate

    • Power analysis should be conducted prior to experiments

For DNA repair studies specifically, somatic homologous recombination frequency data often shows non-normal distributions and may require non-parametric approaches or data transformation before analysis .

How can I integrate multi-omics data to understand At5g66660 function in stress response networks?

For comprehensive integration of multi-omics data to understand At5g66660 function:

  • Data collection and preparation:

    • Transcriptomics: RNA-Seq under multiple stress conditions

    • Proteomics: Shotgun proteomics and phosphoproteomics

    • Metabolomics: Targeted and untargeted approaches

    • Phenomics: High-throughput phenotyping platforms

    • Interactomics: Yeast two-hybrid or AP-MS data

  • Integration approaches:

    • Network analysis

      • Construct protein-protein interaction networks

      • Identify co-expression modules using WGCNA

      • Map At5g66660 within stress-responsive networks

    • Multi-omics factor analysis (MOFA)

      • Identify latent factors explaining variation across datasets

    • Graph-based data integration

      • Heterogeneous networks connecting different data types

  • Validation strategies:

    • Targeted experimental validation of key predictions

    • Cross-validation using independent datasets

    • Comparison with published DNA repair networks

  • Visualization techniques:

    • Cytoscape for network visualization

    • Heatmaps for expression patterns across conditions

    • Pathway enrichment mapping

This integrated approach is particularly valuable for understanding At5g66660 function within the context of known DNA repair pathways. Since SNM-related proteins in Arabidopsis show specific involvement in oxidative stress response pathways rather than general ICL repair (unlike their yeast and mammalian homologs) , network-based approaches can help identify these plant-specific functional adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.