Recombinant Arabidopsis thaliana Vacuolar iron transporter homolog 3 (At3g43630)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
At3g43630; F22J12.3; Vacuolar iron transporter homolog 3; Protein NODULIN-LIKE 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At3g43630
Target Protein Sequence
MESHNTLNLDMEKDQEKAFDYSKRAQWLRAAVLGANDGLVSTASLMMGVGAVKQNVKIMI LTGFAGLVAGACSMAIGEFVSVYSQYDIEVAQMKRETGGEIEKEKLPSPTQAAAASALAF SLGAMVPLLAAAFVKEYKVRIGAIVAAVTLALVMFGWLGAVLGKAPVVKSSLRVLVGGWL AMAITYGFTKLIGSHSHMYV
Uniprot No.

Target Background

Function
Probable vacuolar iron transporter potentially involved in regulating iron distribution within the plant.
Database Links

KEGG: ath:AT3G43630

STRING: 3702.AT3G43630.1

UniGene: At.53700

Protein Families
CCC1 family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Q&A

What is MEB3 and how is it related to the VIT family?

MEB3 (MEMBRANE PROTEIN OF ER BODY 3) is a member of the Vacuolar Iron Transporter (VIT) family in Arabidopsis thaliana. Despite its name suggesting endoplasmic reticulum localization, research has demonstrated that MEB3 functions as a vacuolar metal transporter involved in iron distribution and homeostasis. Unlike other MEB proteins (MEB1 and MEB2) that localize to ER bodies, MEB3 localizes to the tonoplast (vacuolar membrane) where it facilitates iron transport . MEB3 shares functional similarities with other VIT family proteins but shows distinct subcellular localization and tissue-specific expression patterns.

How does MEB3 expression vary across Arabidopsis tissues?

MEB3 exhibits a tissue-specific expression pattern, with highest expression observed in roots and seedlings. Research shows that "MEB3 was expressed in almost all tissues, albeit to higher levels in roots and seedlings" . More specifically, promoter activity studies revealed that "the MEB3 promoter is activated in the root epidermis and strongly activated in the root tip of primary and lateral roots" , indicating a pattern that overlaps with iron accumulation in these tissues. This expression pattern aligns with MEB3's role in iron accumulation in root cells and its involvement in root-to-shoot iron translocation in response to iron availability.

What heterologous expression systems are effective for studying MEB3 function?

Heterologous expression in yeast mutants provides a powerful approach for characterizing MEB3 function. Research demonstrates that "Heterologous expression of Arabidopsis MEB3 in yeast vacuolar iron or zinc transporter mutants restored the iron- and zinc-resistance phenotypes of the respective mutants" . Specifically, expression of MEB3 in the yeast ccc1 mutant (deficient in vacuolar iron transport) complemented its growth inhibition phenotype in high-iron media. When designing such experiments, researchers should consider:

  • Selection of appropriate yeast mutant strains (ccc1 for iron transport studies)

  • Optimization of expression vectors with suitable promoters

  • Growth conditions with varying metal concentrations to test complementation

  • Quantitative growth assays to measure restoration of phenotypes

  • Subcellular localization verification in yeast cells

This approach allows functional characterization of transport activity while eliminating the complexity of plant systems with redundant transporters.

What experimental design considerations are important for studying iron transport activity?

When investigating iron transport activity of MEB3 or related transporters, researchers should implement a systematic experimental design approach. Based on successful studies in the field, effective experimental designs include:

  • In vitro transport assays with purified protein in reconstituted systems

  • Heterologous expression in model organisms (yeast, E. coli)

  • Direct measurement of iron content in cellular compartments

  • Use of radioisotopes or fluorescent iron analogs to track transport

  • Manipulation of pH gradients to test for H⁺/Fe²⁺ exchange mechanisms

For quantitative analysis, researchers should employ statistical approaches as outlined in optimization-based experimental design frameworks, which "offer tremendous benefits for answering causal questions across a wide range of applications" . These methods help maximize information while minimizing experimental costs, particularly important for complex biological systems like iron transport networks.

How does MEB3 contribute to iron distribution between roots and shoots?

MEB3 plays a critical role in the proper distribution of iron between roots and shoots in Arabidopsis. Research shows that "At high iron concentration, meb3 mutants accumulated more iron in shoots and less iron in roots than the wild type, indicating impairment of proper iron distribution in meb3 mutants" . This suggests MEB3 functions in regulating root-to-shoot iron translocation in response to environmental iron availability.

The mechanism appears to involve vacuolar sequestration of iron in root cells, which influences the pool of iron available for translocation to shoots. Under iron-sufficient conditions, MEB3 promotes iron accumulation in root vacuoles, potentially limiting excessive translocation to shoots. When studying this process, researchers should consider:

  • Measuring tissue-specific iron content under varying iron supply conditions

  • Analyzing expression of iron uptake and translocation genes in meb3 mutants

  • Examining potential interactions with phloem loading mechanisms, as "OPT3 loads iron into the phloem, facilitates iron recirculation from the xylem to the phloem, and regulates both shoot-to-root iron signaling"

How do MEB3 and other vacuolar transporters interact in iron homeostasis networks?

MEB3 functions within a complex network of vacuolar transporters that collectively maintain iron homeostasis. Research indicates "vacuolar iron transporters, FPN2, VTL1–5 and MEB3 regulate vacuolar iron contents under iron-sufficient conditions in a functionally redundant manner" . This redundancy explains why "meb3 mutants do not show a complete loss of root iron and growth phenotype" .

When investigating these interactions, researchers should consider:

  • Generation and analysis of higher-order mutants lacking multiple transporters

  • Differential expression analysis under varying iron conditions

  • Protein-protein interaction studies to identify potential complex formation

  • Mathematical modeling of iron flux through multiple transporters

  • Tissue-specific knockout or overexpression of individual transporters

What methods are effective for purifying recombinant MEB3 protein?

Purification of membrane proteins like MEB3 presents significant technical challenges. Effective strategies can be adapted from successful approaches with related transporters: "We report on the heterologous overexpression and purification of PfVIT, a vacuolar iron transporter homologue from the human malaria-causing parasite Plasmodium falciparum. Use of synthetic, codon-optimised DNA enabled overexpression of functional PfVIT in the inner membrane of Escherichia coli" .

Based on this and standard membrane protein purification approaches, a successful protocol might include:

  • Synthetic gene design with codon optimization for the expression host

  • Selection of appropriate expression vectors with affinity tags

  • Optimization of induction conditions to avoid toxicity

  • Detergent screening to identify optimal solubilization conditions

  • Purification using affinity chromatography followed by size exclusion

  • Verification of protein integrity and activity post-purification

StepCritical ParametersTroubleshooting Approaches
Gene DesignCodon optimization, removal of regulatory sequencesSynthesize multiple variants
ExpressionTemperature, inducer concentration, durationScreen multiple conditions using small-scale cultures
Membrane ExtractionBuffer composition, detergent typeTest detergent panel, optimize buffer ionic strength
PurificationDetergent concentration, salt concentrationIncorporate stabilizing additives
Activity VerificationReconstitution method, lipid compositionTest multiple reconstitution approaches

How can iron transport activity be measured in vitro?

Measuring iron transport activity in vitro requires specialized approaches for membrane proteins. Based on methods used for related transporters: "Qualitative transport assays performed on inverted vesicles enriched with PfVIT revealed that the transporter catalysed Fe²⁺/H⁺ exchange driven by the proton electrochemical gradient" .

A comprehensive methodological approach would include:

  • Preparation of proteoliposomes containing purified MEB3

  • Establishment of pH gradients across vesicle membranes

  • Addition of ferrous iron (Fe²⁺) with appropriate reducing agents to prevent oxidation

  • Measurement of iron uptake using atomic absorption spectroscopy or radioactive tracers

  • Controls with ionophores to collapse the pH gradient and verify transport mechanism

Researchers should systematically vary conditions (pH, iron concentration, competing ions) to characterize transport kinetics and specificity.

How should researchers analyze phenotypic data from meb3 mutants?

Analysis of phenotypic data from meb3 mutants requires careful consideration of multiple factors. Research shows that "iron but not zinc levels were reduced in meb3 knockout mutant roots, suggesting that the knockout reduced iron storage capacity in roots" . When analyzing such data, researchers should:

  • Employ appropriate statistical methods for comparing metal content between genotypes

  • Consider tissue-specific effects rather than whole-plant measurements

  • Analyze data under multiple growth conditions (iron-deficient, sufficient, and excess)

  • Examine multiple phenotypic parameters beyond metal content (growth, gene expression)

  • Account for potential redundancy with other transporters

Data should be presented in clearly organized tables following scientific publication standards for data presentation, with proper statistical analysis and appropriate controls.

What approaches are recommended for studying MEB3 regulation under varying iron conditions?

Studying the regulation of MEB3 under different iron conditions requires a multi-faceted approach. Research indicates that MEB3 plays a role in "iron accumulation in Arabidopsis root cells and is involved in root-to-shoot iron translocation in response to iron availability" .

Recommended approaches include:

  • Transcriptional analysis using qRT-PCR or RNA-seq under varying iron supplies

  • Promoter-reporter assays to identify iron-responsive elements

  • Protein level analysis using western blotting with specific antibodies

  • Post-translational modification analysis to identify regulatory mechanisms

  • Examination of interactions with known iron-sensing pathways

Data from these studies should be integrated to develop a comprehensive model of MEB3 regulation in the context of whole-plant iron homeostasis.

How might structural studies advance our understanding of MEB3 function?

Structural studies of MEB3 would significantly advance understanding of its transport mechanism. Research on related transporters has identified "amino acid residues crucial for the iron transport activity of EgVIT1" , though "some of these residues were not conserved in the VTL and MEB subfamilies" , suggesting unique structural features.

Future research directions might include:

  • Cryo-EM structure determination of purified MEB3

  • Computational modeling based on homologous transporters

  • Structure-guided mutagenesis to identify critical residues

  • Analysis of how structural features determine subcellular targeting

  • Investigation of potential conformational changes during transport cycle

These approaches would provide insights into the molecular basis of MEB3's iron transport specificity and regulation.

What are promising approaches for studying the interplay between iron and other metal homeostasis pathways?

MEB3 appears to have broader roles in metal homeostasis beyond iron. Research shows "MEB3 regulates iron and zinc transport" , suggesting interconnections between different metal homeostasis pathways. Additionally, other research has uncovered "crosstalk between iron homeostasis and cadmium partitioning" .

Promising research approaches to investigate these interconnections include:

  • Multi-element analysis of tissues from wild-type and meb3 mutants

  • Transport assays with competing metals to determine specificity

  • Transcriptomic analysis under varying metal combinations

  • Genetic interaction studies with transporters for other metals

  • Investigation of shared regulatory mechanisms across metal homeostasis pathways

Such studies could reveal how plants coordinate the homeostasis of multiple essential and toxic metals, with potential applications for biofortification and phytoremediation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.