Recombinant Arabidopsis thaliana Vacuolar protein sorting-associated protein 55 homolog (At1g32410)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
At1g32410; F5D14.32; Vacuolar protein sorting-associated protein 55 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At1g32410
Target Protein Sequence
MADVPGYLRTCLDMGKIAFLAILVSTGIVLQILACALFNNWWPMLSVIMYVLLPMPLLFF GGSDSTSLFNESDNSWINAAKFLTGASAVGSVAIPSILKHAGLIGWGALALDLSSYVVFL VAILGYICIGDASDNYYSYI
Uniprot No.

Target Background

Function
Involved in endosomal protein transport.
Database Links

KEGG: ath:AT1G32410

STRING: 3702.AT1G32410.1

UniGene: At.15526

Protein Families
OB-RGRP/VPS55 family
Subcellular Location
Endosome membrane; Multi-pass membrane protein.

Q&A

What is the functional role of VPS55 in Arabidopsis thaliana?

VPS55 in Arabidopsis thaliana is believed to function as part of the vacuolar protein sorting machinery, similar to other VPS proteins like VPS29. While VPS29 has been demonstrated to play a crucial role in recycling vacuolar sorting receptors (VSRs) from the prevacuolar compartment (PVC) to the trans-Golgi network (TGN) , VPS55 likely participates in a different aspect of vacuolar trafficking. Based on homology with other systems, VPS55 is expected to be involved in late endosome-to-vacuole trafficking steps, potentially functioning in membrane fusion events. This is inferred from studies showing that vacuolar protein sorting proteins form specialized complexes that orchestrate protein movement between cellular compartments .

How does VPS55 differ from other VPS proteins in the Arabidopsis vacuolar sorting system?

VPS55 differs from other VPS proteins like VPS29 in terms of its structural properties and likely its position in the vacuolar trafficking pathway. While VPS29 functions as part of the retromer complex that is essential for recycling VSRs , VPS55 is predicted to operate in later trafficking steps. Unlike VPS29, which works with VPS26 and VPS35 in the cargo-selective subcomplex of the retromer , VPS55 likely functions in membrane fusion events at the vacuole. The differences in these proteins highlight the complexity of the plant vacuolar sorting system, which involves multiple protein complexes operating at different stages of the trafficking pathway.

What phenotypes are observed in VPS55 mutants?

Based on studies of similar VPS proteins in Arabidopsis, VPS55 mutants would likely exhibit defects in vacuolar morphology and protein trafficking. For comparison, knockdown mutations in VPS29 (such as in the maigo1-1 mutant) result in defective trafficking of soluble proteins to the lytic vacuole . Specifically, the trafficking of proteins from the TGN to the PVC is impaired. Similar phenotypes, possibly with differences in severity or specific affected pathways, would be expected in VPS55 mutants. Additionally, mutants might show growth abnormalities, altered responses to stress, or developmental defects depending on the specific role of VPS55 in different tissues and developmental stages.

How does VPS55 interact with the retromer complex in Arabidopsis?

While VPS55 is not a core component of the retromer complex itself (which includes VPS29, VPS35, and VPS26) , it likely interacts with this machinery at specific points in the vacuolar trafficking pathway. Research approaches to investigate these interactions would include co-immunoprecipitation studies, yeast two-hybrid assays, and in vivo fluorescence resonance energy transfer (FRET) analyses. The retromer complex in Arabidopsis is involved in recycling VSRs from the PVC to the TGN , and VPS55 may function downstream of this process, potentially receiving cargo that has been sorted by the retromer machinery. Elucidating these interactions would provide insight into the coordination of different steps in the vacuolar trafficking pathway.

What role does VPS55 play in stress responses in Arabidopsis?

Given the importance of vacuolar function in plant stress responses, VPS55 likely contributes to stress adaptation mechanisms. Research indicates that proper vacuolar trafficking is essential for responses to various stresses, including drought, salinity, and pathogen attack. Experimental approaches to investigate this would include subjecting VPS55 mutants or overexpression lines to different stress conditions and analyzing phenotypic responses, measuring stress-related gene expression, and examining changes in vacuolar morphology and function. Similar to how other VPS proteins are essential for proper protein localization under normal conditions , VPS55 may play specific roles in redirecting protein trafficking under stress conditions.

How does VPS55 expression vary across different tissues and developmental stages?

Understanding the spatiotemporal expression pattern of VPS55 would provide insights into its biological functions in different contexts. This could be investigated using promoter-reporter constructs, in situ hybridization, and tissue-specific transcriptome analyses. Based on patterns observed with other vacuolar trafficking components, VPS55 expression might vary across tissues with different vacuolar demands, such as developing seeds, guard cells, or root tips. The expression pattern would help identify specific biological processes in which VPS55 plays crucial roles, potentially revealing functions beyond basic vacuolar trafficking.

What are the most effective strategies for producing recombinant Arabidopsis thaliana VPS55?

For producing recombinant Arabidopsis thaliana VPS55, researchers should consider several expression systems, each with specific advantages. Bacterial expression (E. coli) provides high yield but may lack post-translational modifications. The protocol typically involves:

  • Cloning the At1g32410 coding sequence into an appropriate expression vector (pET or pGEX systems)

  • Transforming into an expression strain like BL21(DE3)

  • Optimizing induction conditions (IPTG concentration, temperature, time)

  • Protein extraction using mild detergents considering VPS55's membrane association

  • Purification via affinity chromatography using His-tag or GST-tag systems

For more native protein conditions, expression in yeast (P. pastoris) or insect cells may provide better folding and post-translational modifications. For functional studies, transient expression in Arabidopsis protoplasts offers advantages for tracking protein localization and interactions .

What imaging techniques are most suitable for studying VPS55 localization and dynamics?

Optimal imaging of VPS55 localization and dynamics requires multiple complementary approaches:

  • Confocal Laser Scanning Microscopy (CLSM) with VPS55-fluorescent protein fusions (GFP/mCherry) provides excellent resolution for subcellular localization

  • Super-resolution techniques like Stimulated Emission Depletion (STED) or Structured Illumination Microscopy (SIM) overcome the diffraction limit for detailed localization

  • Spinning disk confocal microscopy is preferable for live-cell imaging to capture rapid dynamics with reduced photobleaching

  • Fluorescence Recovery After Photobleaching (FRAP) and photoactivation techniques reveal protein mobility and turnover rates

  • Multi-channel imaging with established markers for TGN, PVC, and vacuolar membranes distinguishes precise compartmental localization

For quantitative analysis, specialized software like ImageJ with appropriate plugins for colocalization analysis (JACoP) and particle tracking should be employed. When using Arabidopsis protoplasts as model systems, careful optimization of transformation and imaging conditions is essential to minimize artifacts .

How can researchers effectively analyze protein-protein interactions involving VPS55?

Multiple complementary approaches should be used to analyze VPS55 protein-protein interactions:

  • Yeast two-hybrid (Y2H) screening can identify potential interactors, though false positives require validation

  • Co-immunoprecipitation (Co-IP) followed by mass spectrometry provides in vivo verification of interactions

  • Bimolecular Fluorescence Complementation (BiFC) visualizes interactions in plant cells and indicates subcellular localization

  • Förster Resonance Energy Transfer (FRET) measured by acceptor photobleaching or fluorescence lifetime imaging microscopy (FLIM) provides quantitative interaction data

  • Pull-down assays with recombinant proteins confirm direct interactions

When analyzing these interactions, researchers should consider membrane association of VPS55, which may require specialized detergents for extraction while maintaining protein-protein interactions. As demonstrated with other VPS proteins, interactions might be transient or condition-dependent , requiring careful experimental design to capture them effectively. Crosslinking approaches may help stabilize transient interactions for subsequent analysis.

How should researchers interpret contradictory results between in vitro and in vivo studies of VPS55 function?

When confronted with contradictory results between in vitro and in vivo studies of VPS55 function, researchers should systematically analyze several factors:

  • Protein conformation differences: In vitro systems may not replicate the native folding or post-translational modifications of VPS55

  • Missing cofactors: In vitro systems might lack essential protein partners or lipid environments required for proper VPS55 function

  • Compartmentalization effects: The spatial organization within cells impacts VPS55 activity in ways difficult to reproduce in vitro

  • Temporal dynamics: In vivo systems capture the dynamic nature of trafficking processes that static in vitro assays might miss

To resolve discrepancies, complementary approaches like in vitro reconstitution of membrane systems with purified components can bridge the gap between simplified and complex systems. Similarly, creating more controlled in vivo systems through inducible expression or optogenetic approaches can help isolate specific functions. As seen with other VPS proteins, contradictions often reveal important regulatory mechanisms or context-dependent functions .

What statistical approaches are most appropriate for analyzing VPS55 mutant phenotypes?

Analyzing VPS55 mutant phenotypes requires rigorous statistical approaches tailored to the specific experimental designs:

  • For quantitative traits (growth measurements, protein trafficking efficiency):

    • ANOVA with appropriate post-hoc tests for comparing multiple genotypes/conditions

    • Linear mixed-effects models when accounting for random factors (e.g., experimental blocks)

    • Non-parametric alternatives (Kruskal-Wallis, Mann-Whitney) when assumptions of normality are violated

  • For categorical outcomes (phenotypic classes, subcellular localization patterns):

    • Chi-square or Fisher's exact tests for frequency comparisons

    • Multinomial logistic regression for multiple category outcomes with covariates

  • For time-series data (developmental progression, protein trafficking kinetics):

    • Repeated measures ANOVA or mixed models with time as a factor

    • Survival analysis techniques for time-to-event data

Sample size calculations should be performed before experiments to ensure adequate statistical power, typically aiming for 80-90% power to detect biologically meaningful effect sizes. When analyzing subtle phenotypes, which are common in vacuolar trafficking mutants , increased replication and careful control of environmental variables are essential for reliable detection of effects.

How can researchers overcome the challenges of protein insolubility when working with recombinant VPS55?

Protein insolubility is a common challenge when working with membrane-associated proteins like VPS55. Researchers can implement several strategies to improve solubility:

  • Expression optimization:

    • Reduce expression temperature (16-20°C)

    • Use lower inducer concentrations

    • Test different expression strains (C41(DE3), C43(DE3) for membrane proteins)

  • Protein engineering approaches:

    • Express soluble domains separately

    • Create fusion proteins with solubility-enhancing tags (MBP, SUMO)

    • Remove hydrophobic regions if they're not essential for the studied function

  • Extraction and purification conditions:

    • Screen detergent panels (mild non-ionic detergents like DDM or CHAPS)

    • Use specialized buffers with stabilizing agents (glycerol, specific salt concentrations)

    • Implement gentle lysis methods to preserve native structure

  • Alternative approaches:

    • Cell-free expression systems

    • Insect cell expression for better membrane protein folding

    • Co-expression with binding partners that may enhance solubility

When analyzing results from different solubilization methods, researchers should verify that the protein maintains its functional properties through activity assays or structural analyses, as some solubilization approaches might yield soluble but non-functional protein.

What strategies can address non-specific binding issues when studying VPS55 interactions?

Non-specific binding presents significant challenges when studying protein interactions involving VPS55. Researchers can implement several strategies to minimize these issues:

  • Optimization of binding conditions:

    • Increase stringency with higher salt concentrations or mild detergents

    • Add competing agents like BSA or non-specific DNA/RNA to block non-specific interactions

    • Optimize pH and buffer composition based on VPS55's biochemical properties

  • Control experiments:

    • Include appropriate negative controls (unrelated proteins with similar properties)

    • Perform reverse pull-downs to confirm interactions

    • Use unrelated tags as controls for tag-based interactions

  • Analytical approaches:

    • Implement quantitative proteomics with SILAC or TMT labeling to distinguish true interactors

    • Analyze interaction stoichiometry to identify non-physiological interactions

    • Apply stringent statistical filtering to mass spectrometry results

  • Validation methods:

    • Confirm key interactions with multiple independent techniques

    • Perform mutational analysis of predicted binding interfaces

    • Test interaction dependencies on relevant cellular conditions

These approaches have proven effective when studying other VPS proteins and can be adapted for VPS55 research, taking into account its specific biochemical properties and cellular context.

What emerging technologies could advance our understanding of VPS55 function in Arabidopsis?

Several cutting-edge technologies hold promise for deeper insights into VPS55 function:

  • CRISPR-based approaches:

    • CRISPR interference (CRISPRi) for conditional knockdown

    • Base editing for introducing specific mutations

    • Prime editing for precise sequence modifications

    • CRISPR activation (CRISPRa) for controlled overexpression

  • Advanced imaging technologies:

    • Lattice light-sheet microscopy for high-speed 3D imaging with minimal phototoxicity

    • Correlative light and electron microscopy (CLEM) to connect fluorescent protein localization with ultrastructural details

    • Expansion microscopy for enhanced resolution of protein complexes

    • Live-cell single-molecule tracking to follow individual VPS55 molecules

  • Protein structure and interaction technologies:

    • AlphaFold2-based structural predictions combined with experimental validation

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction surfaces

    • Proximity labeling techniques (BioID, TurboID) to identify transient interactors

    • Single-cell proteomics to detect cell-specific variations in VPS55 complexes

These technologies could help resolve key questions about VPS55's precise role in membrane trafficking, potentially revealing unexpected functions similar to how multiple roles were discovered for other VPS proteins .

How might VPS55 function be integrated into broader models of plant vacuolar trafficking?

Integrating VPS55 function into comprehensive models of plant vacuolar trafficking requires connecting it to established trafficking pathways and molecular mechanisms:

  • Systems biology approaches:

    • Construct protein interaction networks incorporating VPS55 and related proteins

    • Develop mathematical models of trafficking dynamics that include VPS55 function

    • Apply machine learning to predict cellular responses to VPS55 perturbations

  • Comparative genomics:

    • Analyze VPS55 conservation across plant species to identify functionally important domains

    • Compare VPS55 with homologs in other eukaryotes to identify plant-specific features

    • Investigate co-evolution patterns with interacting proteins

  • Integration with established pathways:

    • Determine relationships with retromer-mediated trafficking

    • Investigate connections to SNARE-mediated membrane fusion events

    • Explore links to Rab GTPase regulatory networks

    • Examine potential roles in unconventional protein secretion pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.