Recombinant Arabidopsis thaliana WPP domain-interacting protein 1 (WIP1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer needs.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
WIP1; At4g26455; M3E9.120; WPP domain-interacting protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-489
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
WIP1
Target Protein Sequence
MDLESESSALESVDDNVLIQQSASNVCDDGRSLDNGSCSDESVKLLSTSNSVELGKPMSF DSPGDGGGAYSPVLKGQGLRKWRRIRRDLVKDTSANMENSKALKRGLSGVAHSHGKQMQF QSPEVEQESQGSVGSVNMLKSSGDGFDILGSSGYDSRFVAGVGFSAGMDLEIDDDRSSKS STVARAPKVIRYEKPMISSGQGGNIRVENSKKHRGESVDFEKENSYSSLESDSRKQSGRM MDYNGENGETSMRKDDAGGEGGESINTDNRYSDEMDPLTEAINGFLALQDALEKEVQQFQ EIGNEPMPQHHEQVSEANSPHPEIVTLVNNVEQLENMLEETRSMLEVKESHIRDLESTTN QSKHSWGGTEIVVEDIFRQKIEAEIEYLIYSRSIDNLNSQMKLIDEQESLAEEQTHETLN KLGRVQTKAANFTNRAQDLQNDCIEITGTIKKRACKITSYVLIQLVLLSTVVLLLLSQLL PEPDTVVPT
Uniprot No.

Target Background

Function
This protein mediates and enhances the nuclear envelope docking of RANGAP proteins via WIT1 and WIT2 in undifferentiated root tip cells. As a component of the SUN-WIP-WIT2-KAKU1 complex, it facilitates the transmission of cytoplasmic forces to the nuclear envelope (NE), thereby influencing nuclear morphology.
Database Links

KEGG: ath:AT4G26455

STRING: 3702.AT4G26455.1

UniGene: At.74538

Subcellular Location
Nucleus envelope. Nucleus membrane; Single-pass membrane protein; Cytoplasmic side. Note=Targeted to the nuclear envelope (NE) during interphase. Associated to the cell plate during cytokinesis in root tips.
Tissue Specificity
Expressed in seedlings, roots, stems, leaves, and flowers.

Q&A

What is WIP1 and what is its primary function in Arabidopsis thaliana?

WIP1 (WPP domain-interacting protein 1) is a plant-specific protein that localizes to the nuclear envelope in Arabidopsis thaliana. It functions as a key component of the plant LINC (Linker of Nucleoskeleton and Cytoskeleton) complex, which bridges the nucleoskeleton to the cytoskeleton. WIP1 interacts with Sad1/UNC-84 (SUN) proteins and WPP domain-interacting tail-anchored proteins (WITs) at the nuclear envelope to form this bridging complex. The primary function of WIP1 appears to be in nuclear shape determination and positioning, as demonstrated by mutant studies where alterations in WIP proteins lead to changes in nuclear morphology . This protein contributes to the proper elongation of nuclei, particularly in specialized cell types such as root hairs and trichomes where nuclear shape is strictly regulated during development.

How does WIP1 interact with other nuclear envelope proteins?

WIP1 participates in a complex protein interaction network at the nuclear envelope. It directly interacts with SUN domain proteins (SUN1 and SUN2), which are inner nuclear membrane proteins with domains extending into the perinuclear space. On the cytoplasmic side, WIP1 interacts with WIT proteins (particularly WIT1 and WIT2), which in turn bind to myosin XI-i . Co-immunoprecipitation experiments have confirmed these interactions, with GFP-tagged WIT2 shown to co-immunoprecipitate with Myc-tagged WIP1, WIP2, and WIP3 in Nicotiana benthamiana leaves . The interaction between WIP1 and WIT proteins is critical for nuclear shape determination, as this complex transfers cytoskeletal forces to the nuclear envelope. Additionally, immunoprecipitation experiments have demonstrated that a truncated form of WIT2 (designated WIT2*) is able to bind WIP1, suggesting that specific domains of WIT2 are sufficient for this interaction .

What is the relationship between WIP1 and the WPP domain?

The WPP domain is a plant-unique protein domain first identified in Arabidopsis RanGAP1, a GTPase-activating protein involved in nucleocytoplasmic transport and mitotic progression. WIP1 was discovered as a protein that interacts with this WPP domain, hence its name (WPP domain-interacting protein 1). The WPP domain of RanGAP1 is necessary and sufficient for targeting to the nuclear envelope during interphase and to the phragmoplast midline/cell plate during cytokinesis . In the case of RanGAP1, mutation of key residues in the WPP motif to AAP disrupts its localization to the nuclear envelope and other mitotic structures . WIP1 recognizes and binds to this domain, forming part of the mechanism by which WPP domain-containing proteins are properly localized. This interaction represents an important targeting mechanism specific to plant cells, as animal cells use different protein interactions for nuclear envelope targeting.

What phenotypes are observed in wip1 mutant plants?

The phenotypic effects of wip1 mutations are best understood in the context of nuclear shape and positioning. In Arabidopsis, mutant analysis has revealed that WIP proteins are essential for nuclear elongation in various epidermal cell types. While single wip1-1 mutants show subtle phenotypes, more pronounced effects are observed in combination with mutations in other WIP family members (WIP2 and WIP3). In studies of Arabidopsis root hair and trichome cells, disruption of the WIP proteins leads to altered nuclear morphology, with nuclei becoming more rounded rather than elongated . Nuclei in WIP mutants often show invaginations, similar to phenotypes observed in sun or wit mutants . This indicates that the SUN-WIP-WIT complex functions as a unit to maintain nuclear shape. The phenotypes suggest that WIP1 and its family members are involved in transferring forces from the cytoskeleton to the nuclear envelope, which is necessary for proper nuclear elongation during development of specialized cell types.

How does WIP1 contribute to the LINC complex function in nuclear shape determination?

WIP1 serves as a crucial adaptation component in the plant-specific LINC (Linker of Nucleoskeleton and Cytoskeleton) complex, which determines nuclear shape through two independent but complementary mechanisms. First, WIP1 forms a bridge between SUN proteins (located in the inner nuclear membrane) and WIT proteins (particularly WIT2) in the outer nuclear membrane. This SUN-WIP-WIT2-myosin XI-i complex transfers cytoskeletal forces to the nuclear envelope, directly influencing nuclear morphology . Experimental evidence comes from mutant analyses where the loss of any component in this chain leads to similar nuclear shape defects—specifically, round and invaginated nuclei rather than elongated forms .

Intriguingly, the nuclear shape determination mechanism involving WIP1 appears to operate independently from another pathway involving CRWN1 (CROWDED NUCLEI 1), a plant analog of lamins. While crwn1 mutant nuclei are smooth and round, sun or wit mutant nuclei show distinctive invaginations . This indicates that nuclear shape in plants is determined by at least two independent mechanisms: the SUN-WIP-WIT2-myosin XI-i complex transferring cytoplasmic forces to the nuclear envelope, and CRWN1 forming nucleoplasmic filaments under the nuclear envelope . The specific contribution of WIP1 is therefore as a key adapter in the force-transfer pathway, without which nuclei cannot maintain their elongated morphology in specialized cell types.

What are the functional differences between WIP1, WIP2, and WIP3 in Arabidopsis?

The cellular distribution and expression patterns of the three WIP proteins might also differ. While all localize to the nuclear envelope, their abundance in different tissues or their response to developmental or environmental cues may vary. Future research employing tissue-specific promoter analysis and quantitative expression studies would help elucidate these differences and clarify the unique roles of each WIP protein in Arabidopsis development and stress responses.

How can researchers effectively express and purify recombinant WIP1 for in vitro studies?

For successful expression and purification of recombinant Arabidopsis WIP1, researchers should consider the following methodological approach:

Expression Systems Selection:

Optimization Parameters:

  • Codon Optimization: Customize codons for the expression system to improve translation efficiency.

  • Expression Temperature: Lower temperatures (16-18°C) during induction often improve solubility.

  • Fusion Tags: Consider using solubility-enhancing tags like MBP (maltose-binding protein) or SUMO in addition to affinity tags.

Purification Strategy:

  • Initial Capture: Affinity chromatography using Ni-NTA (for His-tagged proteins) or glutathione resin (for GST-fusion).

  • Tag Removal: Include a protease site (TEV or PreScission) between the tag and WIP1 for tag removal after initial purification.

  • Secondary Purification: Size exclusion chromatography to obtain homogeneous protein and remove aggregates.

  • Buffer Optimization: Include reducing agents (DTT or β-mercaptoethanol) to maintain any critical cysteine residues in reduced form, and low concentrations of non-ionic detergents may help stabilize this membrane-associated protein.

By implementing these approaches, researchers can produce sufficient quantities of functional recombinant WIP1 for biochemical and structural studies, enabling deeper analysis of its interactions with partner proteins and its role in nuclear envelope organization.

What techniques are most effective for studying WIP1 localization and dynamics?

Several complementary imaging techniques have proven effective for studying WIP1 localization and dynamics in plant cells:

Fluorescent Protein Fusion Approaches:

  • C-terminal vs. N-terminal Fusions: When creating WIP1-fluorescent protein fusions, consider that C-terminal fusions may interfere with membrane anchoring. N-terminal fusions (e.g., GFP-WIP1) have been successfully used to preserve functionality while allowing visualization .

  • Photoactivatable Fluorescent Proteins: Using photoactivatable GFP (PA-GFP) fusions with WIP1 enables pulse-chase experiments to track protein movement and turnover at the nuclear envelope.

  • Split Fluorescent Protein Systems: Techniques like bimolecular fluorescence complementation (BiFC) are valuable for visualizing WIP1 interactions with binding partners like WIT proteins or SUN proteins in living cells.

Advanced Microscopy Methods:

  • Spinning Disk Confocal Microscopy: Provides rapid acquisition rates needed to capture dynamic movements of WIP1 at the nuclear envelope.

  • FRAP (Fluorescence Recovery After Photobleaching): Essential for measuring WIP1 mobility and exchange rates within the nuclear membrane.

  • Single Molecule Tracking: Super-resolution techniques like PALM (Photoactivated Localization Microscopy) can track individual WIP1 molecules to reveal diffusion patterns and binding dynamics.

Immunofluorescence Approaches:
When studying endogenous WIP1, indirect immunofluorescence using specific antibodies provides visualization without the need for genetic modification. This technique has been successfully employed to study related proteins like RanGAP1 in Arabidopsis root tip cells .

Considerations for Experimental Design:

  • Cell Type Selection: Root hairs and trichomes have proven ideal for nuclear shape studies due to their consistently elongated nuclei .

  • Temporal Resolution: When studying dynamic processes, acquisition rates of at least 1 frame per second are recommended.

  • Environmental Controls: Maintain consistent temperature and imaging conditions, as nuclear dynamics can be affected by environmental stresses.

By combining these approaches, researchers can comprehensively map the localization, interactions, and dynamic behavior of WIP1 at the plant nuclear envelope, providing insights into its role in nuclear architecture and function.

How can the Wip1 promoter be characterized and utilized in transgenic plants?

The characterization and utilization of the Wip1 promoter offers powerful tools for controlled gene expression in plant biotechnology. Based on experimental findings, researchers should consider the following methodological approach:

Promoter Truncation Analysis:
Studies of the maize Wip1 promoter have revealed that specific truncated versions exhibit dramatically different activities. Notably, the Wip1-1231 promoter (a specific truncation at position 1231) shows remarkably strong activity in transgenic Arabidopsis and tobacco plants, while the full-length promoter (Wip1-1737) and other truncated versions display weak or no activity . This indicates the presence of both enhancer and repressor elements within different regions of the promoter sequence.

Experimental Strategy for Promoter Analysis:

  • Sequential Truncation: Generate a series of truncated promoters (as demonstrated with Wip1-1737, Wip1-1500, Wip1-1231, Wip1-1191, Wip1-791, Wip1-491) fused to a reporter gene like GUS .

  • Transformation Methods: Use Agrobacterium-mediated transformation to introduce these constructs into model plants.

  • Transgene Confirmation: Employ PCR analysis of genomic DNA using reporter gene-specific primers to confirm successful transformation .

  • Quantitative Analysis: Measure reporter gene activity using quantitative assays (e.g., fluorometric GUS assay for β-glucuronidase activity) .

  • Histochemical Verification: Complement quantitative data with visual confirmation through histochemical staining of plant tissues .

Applications in Research:

  • Controlled Gene Expression: The highly active Wip1-1231 promoter fragment can drive strong expression of genes of interest in transgenic plants.

  • Tissue-Specific Studies: By characterizing the tissue specificity of Wip1 promoter activity, researchers can develop tools for targeted gene expression.

  • Developmental Regulation: Temporal activity patterns of the promoter can be exploited for stage-specific gene expression.

Cross-Species Application:
Importantly, the Wip1-1231 promoter maintains its strong activity across different plant species, including Arabidopsis and tobacco , suggesting broad applicability in plant biotechnology. This cross-species functionality makes it a valuable tool for comparative studies and biotechnological applications in diverse plant systems.

Promoter VersionRelative Activity in TobaccoRelative Activity in ArabidopsisRecommended Application
Wip1-1737 (full)Very lowVery lowStudies requiring minimal expression
Wip1-1500Very lowVery lowNot recommended for expression studies
Wip1-1231Very highVery highStrong constitutive expression
Wip1-1191LowLowLow-level expression studies
Wip1-791Very lowVery lowNot recommended for expression studies
Wip1-491Very lowVery lowNot recommended for expression studies

This methodical characterization enables researchers to strategically employ Wip1 promoter variants for precise control of transgene expression in plant systems.

What genetic approaches are most effective for studying WIP1 function?

Elucidating WIP1 function requires sophisticated genetic approaches that go beyond simple knockout studies. The following methodological strategies have proven effective:

Mutant Analysis Approaches:

  • Single vs. Multiple Mutants: Due to functional redundancy among WIP family members, analyzing wip1-1 single mutants alongside double (e.g., wip1-1 wip2-1) and triple (wip1-1 wip2-1 wip3-1) mutants is essential for comprehensive phenotypic assessment . The single wip1-1 mutant often shows subtle phenotypes that become more pronounced in multiple mutant combinations.

  • Allelic Series: Generating an allelic series (null, hypomorphic, and gain-of-function alleles) provides insights into domain-specific functions of WIP1.

  • Conditional Mutations: Temperature-sensitive or chemically-inducible mutations allow temporal control over WIP1 function, helping dissect its roles at specific developmental stages.

Advanced Genome Editing Strategies:

  • Domain-Specific Editing: Using CRISPR-Cas9 to create precise modifications in specific WIP1 domains rather than complete gene knockouts.

  • Base Editing: Employing cytosine or adenine base editors for generating specific amino acid substitutions to test structure-function hypotheses.

  • Prime Editing: This technique allows for precise nucleotide replacement without double-strand breaks, enabling subtle modifications to regulatory regions or coding sequences.

Synthetic Biology Approaches:

  • Domain Swapping: Creating chimeric proteins where domains of WIP1 are exchanged with those from WIP2 or WIP3 to determine domain-specific functions.

  • Orthogonal WIP Systems: Introducing WIP proteins from other plant species to test functional conservation and specificity.

  • Optogenetic Control: Engineering light-responsive WIP1 variants to achieve spatiotemporal control over its activity and interactions.

Genetic Interaction Studies:

  • Systematic Double Mutant Analysis: Crossing wip1 mutants with mutants in interacting proteins (sun1, sun2, wit1, wit2, myosin XI-i, crwn1) to establish epistatic relationships .

  • Suppressor Screens: Identifying genetic suppressors of wip1 mutant phenotypes to discover novel components of the nuclear envelope regulation pathway.

  • Synthetic Lethality Screening: Identifying gene combinations that, when mutated together with WIP1, cause lethality even though individual mutations are viable.

These sophisticated genetic approaches, when combined with cell biological and biochemical methods, provide a comprehensive understanding of WIP1 function in nuclear architecture and dynamics. The choice of method should be guided by the specific aspects of WIP1 function under investigation, with consideration for the technical feasibility and resources available.

How should researchers interpret nuclear morphology changes in WIP1 mutant studies?

Quantitative Assessment Methods:

  • Appropriate Metrics: Different cell types require different quantification approaches. For root hair nuclei, which display irregular elongated "tails," measuring nuclear length provides the most sensitive index of morphological changes . For trichome nuclei, which exhibit more regular spindle-like or round shapes, the ratio of width to length (circularity index) offers better quantification .

  • Standardized Imaging Parameters: Maintain consistent imaging conditions (magnification, resolution, sample preparation) across all experimental groups to enable valid comparisons.

  • Statistical Rigor: Apply appropriate statistical tests based on data distribution. The two-tailed t-test has been effectively used to compare nuclear morphology between wild-type and mutant plants .

Interpretation Framework:

  • Comparative Analysis: Nuclear phenotypes in wip1 mutants should be interpreted in the context of other nuclear envelope protein mutants. For example, the rounded and invaginated nuclei observed in wit2-1 are similar to those in wit1-1 wit2-1 double mutants, indicating that WIT2 plays the predominant role in this complex .

  • Phenotypic Categories: Nuclear morphology defects in LINC complex mutants typically fall into distinct categories:

    • Shape changes (elongated → round)

    • Surface alterations (smooth → invaginated)

    • Size differences (normal → reduced)

  • Cell Type Specificity: WIP1-related nuclear morphology phenotypes are most pronounced in specialized cell types like root hairs and trichomes . This cell-type specificity must be considered when interpreting results.

Distinguishing Direct vs. Indirect Effects:

Nuclear PhenotypeWild Typewip1-1wit2-1sun1-KO sun2-KDcrwn1-1
ShapeElongatedSlightly roundedRoundRoundRound
SurfaceSmoothSlightly invaginatedInvaginatedInvaginatedSmooth
Root hair nucleus lengthLongSlightly reducedSignificantly reducedSignificantly reducedReduced
Trichome nucleus circularityLowSlightly increasedSignificantly increasedSignificantly increasedIncreased

By applying these quantitative approaches and interpretation frameworks, researchers can extract meaningful insights from nuclear morphology data in WIP1 studies, distinguishing between different mechanisms of nuclear shape determination and the specific contributions of WIP1 to nuclear architecture.

What are the key considerations for protein interaction studies involving WIP1?

Protein interaction studies involving WIP1 require careful experimental design and rigorous controls to generate reliable and biologically meaningful data:

Selection of Appropriate Interaction Assay:

  • Co-Immunoprecipitation (Co-IP): The gold standard for confirming protein-protein interactions in near-native conditions. For WIP1 studies, this approach has successfully demonstrated interactions with WIT proteins and indirectly with myosin XI-i . When performing Co-IP with WIP1:

    • Include appropriate negative controls (e.g., GFP-NLS-GFP-NES has been used as a control for GFP-fusion proteins )

    • Use epitope tags that don't interfere with protein function (N-terminal tags are often preferred for WIP1)

    • Verify expression levels of both bait and prey proteins by immunoblotting

  • Yeast Two-Hybrid (Y2H): Useful for mapping interaction domains, as demonstrated with related WPP-domain interactions with POK1 . For WIP1:

    • Test both full-length and domain-specific constructs to map interaction regions

    • Control for autoactivation and expression levels

    • Confirm interactions using an orthogonal method

  • In vivo Approaches: Bimolecular Fluorescence Complementation (BiFC) or Förster Resonance Energy Transfer (FRET) provide spatial information about interactions within cells.

Protein Expression Systems:

  • Heterologous Expression: Nicotiana benthamiana leaf expression systems have proven effective for WIP1 interaction studies . This system:

    • Provides a plant cellular environment

    • Allows for rapid testing of multiple protein combinations

    • Supports proper post-translational modifications

  • Native Expression Levels: When possible, complement heterologous expression data with studies of endogenous proteins using:

    • Specific antibodies against native proteins

    • Knock-in fluorescent tags at endogenous loci

Data Analysis and Interpretation:

  • Interaction Network Modeling: Place individual WIP1 interactions in the context of the broader nuclear envelope interaction network. The SUN-WIP-WIT2-myosin XI-i pathway represents a functional module within this network .

  • Quantitative Assessment: When possible, quantify interaction strengths to distinguish between:

    • High-affinity, stoichiometric interactions

    • Weak or transient interactions

    • Non-specific binding

  • Structure-Function Correlation: Connect interaction data with functional outcomes. For example, the interaction between WIT2 and WIP1 correlates with nuclear shape determination, as evidenced by similar phenotypes when either protein is disrupted .

Common Pitfalls and Solutions:

  • Membrane Protein Challenges: As a nuclear envelope-associated protein, WIP1 may be difficult to extract in native form. Using specialized detergents (e.g., digitonin or DDM) at low concentrations can help maintain native conformation while solubilizing membrane proteins.

  • Indirect vs. Direct Interactions: Distinguish between direct binding and co-presence in larger complexes by:

    • Using in vitro binding assays with purified components

    • Employing proximity labeling approaches (BioID, APEX) to map the local interaction environment

  • Developmental and Cell-Type Specificity: Consider that WIP1 interactions may vary across:

    • Different developmental stages

    • Cell types with distinct nuclear morphologies

    • Responses to environmental stresses

By carefully addressing these considerations, researchers can generate high-confidence interaction data for WIP1, advancing understanding of its role in nuclear envelope organization and function.

What are the emerging research frontiers for WIP1 in plant cell biology?

The study of WIP1 and related nuclear envelope proteins represents a dynamic area of plant cell biology with several exciting frontiers for future investigation:

Structural Biology Approaches:
The three-dimensional structure of WIP1 and its complexes remains largely unexplored. Advances in cryo-electron microscopy and integrative structural biology could reveal the molecular architecture of plant-specific nuclear envelope complexes. Understanding how WIP1 structurally interfaces with SUN proteins and WIT proteins would provide mechanistic insights into force transmission across the nuclear envelope. Comparative structural studies between WIP family members could explain their functional specificities despite sequence similarities.

Evolutionary Perspectives:
WIP proteins appear to be plant-specific adaptations for nuclear envelope organization. Comparative genomic and functional studies across diverse plant lineages (from algae to angiosperms) would illuminate how these proteins evolved alongside plant-specific cellular features. Such research could reveal whether WIP proteins represent convergent or divergent evolution compared to animal KASH proteins, which serve analogous functions in metazoan LINC complexes despite lacking sequence homology.

Mechanical Biology of the Plant Nucleus:
The role of WIP1 in nuclear shape determination points to broader questions about nuclear mechanobiology in plants. Future research should investigate how mechanical forces are sensed and transduced at the plant nuclear envelope, potentially involving WIP1-containing complexes. Studying whether and how WIP1-mediated connections influence chromatin organization and gene expression would connect nuclear architecture to genome function. Quantitative biophysical approaches could measure how WIP1 complexes respond to mechanical perturbations.

Systems Biology Integration:
Moving beyond individual protein interactions, future research should place WIP1 in the context of integrated cellular networks. Proteomics, transcriptomics, and metabolomics approaches could reveal how WIP1 dysfunction affects global cellular systems. Network analysis may uncover unexpected connections between nuclear envelope organization and other cellular processes like stress responses or developmental transitions. Such integrative approaches could explain why nuclear shape is so strictly regulated in specialized cell types like root hairs and trichomes.

Translational Applications:
Understanding WIP1 and nuclear envelope biology has potential applications in plant biotechnology. The discovery that truncated Wip1 promoters can drive strong gene expression in multiple plant species provides tools for transgene expression. Engineering nuclear envelope proteins could potentially improve crop resilience to mechanical stresses like wind or drought. Manipulating nuclear positioning and shape might optimize cellular function in specialized plant tissues with agricultural importance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.