Recombinant Arabidopsis thaliana WPP domain-interacting protein 3 (WIP3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
WIP3; At3g13360; MDC11.15; WPP domain-interacting protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-459
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
WIP3
Target Protein Sequence
MNESVPDSVEDNGNSVPANGLLVLPDNDHEEGGVGSPQRSNSVESPGGSVHSTRKGFGLK KWRRIKRDGPVRDEAAPVDDGSKLLKRGLAGLVNPPSKHVEFSSVEARQSSEGSVGSVNM VHHPGVANGFSPDIGCMFAVGQAFEKSEEHSGNTIGGKNVVGGKVVSGSQEKLWSDTIKR ASEERGDIEKEKPCSSLDSDLRSSDFVFSTGSVSVGNHGEKDERLTMNYIGGFSNEGQVK EEVQTYSRSENGNKEDDGESKKNNNHWADKDALADSIRSFAVLQEVLWKEVQSFQELGKE SVLLHSNTDELSSDQPSHQNCKEDNSTSSGSKALILKEKVKLLEHKLEEARAALEAKEAR IQELENSKIESELECIFQRKIETEIEHLMLTRSLSSLQVLQETKKLHSLKEDPVSNRGNI LGKTCKLGFYILTQLILLVSILRFLVLQFSPASRLVIPT
Uniprot No.

Target Background

Function
WIP3 mediates and enhances the nuclear envelope docking of RANGAP proteins, facilitated by WIT1 and WIT2 in undifferentiated root tip cells. As a component of the SUN-WIP-WIT2-KAKU1 complex, WIP3 mediates the transmission of cytoplasmic forces to the nuclear envelope (NE), thereby influencing nuclear morphology.
Database Links

KEGG: ath:AT3G13360

STRING: 3702.AT3G13360.1

UniGene: At.20916

Subcellular Location
Nucleus envelope. Nucleus membrane; Single-pass membrane protein; Cytoplasmic side.
Tissue Specificity
Expressed in seedlings, roots, stems, leaves, and flowers.

Q&A

What is the WIP family and how does WIP3 relate to other members?

The WIP (WPP domain-Interacting Protein) family in Arabidopsis thaliana consists of plant-specific proteins characterized by the presence of a coiled-coil domain and a C-terminal predicted transmembrane domain. This family includes WIP1, WIP2a, and WIP3, which together with WIT (WPP domain-interacting tail-anchored protein) family members, are required for RanGAP1 association with the nuclear envelope in root tips . These proteins are classified as putative tail-anchored (TA) proteins that associate with membranes posttranslationally .

The WIP family is structurally and functionally related to the WIT family, which includes WIT1 and WIT2. Both families contain coiled-coil domains that interact with WPP-domain proteins and are involved in nuclear envelope targeting mechanisms . WIP3 shares significant sequence similarity with WIP1 and WIP2a, particularly in the coiled-coil region that mediates interaction with WPP domain proteins.

What is known about the molecular structure of WIP3?

WIP3, like other members of the WIP family, is characterized by:

  • A coiled-coil domain that mediates protein-protein interactions, particularly with WPP domain proteins

  • A C-terminal predicted transmembrane domain (TMD) that anchors the protein to membranes

  • Classification as a tail-anchored (TA) protein, suggesting posttranslational membrane association

The coiled-coil domain is particularly important for WIP3 function, as it mediates interactions with the WPP domain of proteins such as RanGAP1 and other WPP-domain proteins (WPP1, WPP2) . This interaction is critical for targeting and anchoring RanGAP1 to the nuclear envelope.

What cellular localization pattern does WIP3 exhibit?

WIP3 predominantly localizes to the nuclear envelope in Arabidopsis cells. As a tail-anchored protein, WIP3 is inserted into the outer nuclear membrane posttranslationally, with its N-terminal domain facing the cytoplasm where it can interact with WPP-domain proteins . This localization is consistent with its role in targeting RanGAP1 to the nuclear envelope.

When studying WIP proteins using fluorescent protein fusions (like GFP-WIP3), researchers should be aware that overexpression can sometimes lead to protein aggregation in the cytoplasm, similar to what has been observed with related proteins like WIT1 . Co-expression with chaperones like HSC70-1 or WPP domain proteins may help prevent such aggregation and ensure proper localization.

How do mutations in WIP3 affect plant phenotype?

Mutations in WIP family genes, including WIP3, can lead to defects in nuclear envelope structure and function. While specific phenotypes for WIP3 single mutants may be subtle due to functional redundancy with WIP1 and WIP2a, combined mutations in multiple WIP genes have been shown to affect:

  • RanGAP1 localization at the nuclear envelope in root tip cells

  • Nuclear architecture and organization

  • Plant development, particularly in tissues with high cell division rates

The phenotypic effects are likely related to the importance of proper RanGAP1 localization and function in establishing the RanGTP/RanGDP gradient, which is essential for nucleocytoplasmic transport, mitotic spindle formation, and nuclear envelope assembly.

What specific protein interactions does WIP3 engage in?

WIP3, like other WIP family members, primarily interacts with:

  • WPP-domain proteins (WPP1 and WPP2): These interactions occur through the coiled-coil domain of WIP3 and the WPP domain of these proteins . The three-amino-acid WPP motif is essential for this interaction, as mutations in this motif significantly reduce binding affinity .

  • RanGAP1: WIP3 interacts with the WPP domain of RanGAP1, contributing to its anchoring at the nuclear envelope .

  • Potential interaction with molecular chaperones: Based on what we know about related proteins, WIP3 may interact with molecular chaperones like HSC70 family members during its biogenesis and targeting to the nuclear envelope .

These interactions form part of a complex network at the nuclear envelope that coordinates nuclear structure and function. The specificity of these interactions likely contributes to the precise subcellular localization and function of WIP3.

How does WIP3 contribute to nuclear envelope targeting mechanisms?

WIP3 functions as part of a specialized targeting mechanism for RanGAP1 at the plant nuclear envelope. This process involves:

  • Initial interaction with WPP-domain proteins in the cytoplasm

  • Targeting and insertion of WIP3 into the outer nuclear membrane via its C-terminal transmembrane domain

  • Recruitment and anchoring of RanGAP1 through interaction with its WPP domain

  • Stabilization of this complex at the nuclear envelope

This mechanism is plant-specific and differs from the SUMO-dependent mechanism found in metazoans . The involvement of multiple WIP and WIT proteins suggests a complex and potentially redundant system for ensuring proper RanGAP1 localization, which is critical for establishing the RanGTP gradient that drives nucleocytoplasmic transport.

What regulatory mechanisms control WIP3 expression and function?

The expression and function of WIP3 appear to be regulated at multiple levels:

  • Transcriptional regulation: WIP3 expression may be developmentally regulated, with potential variation across different tissues and developmental stages.

  • Post-translational modifications: Like other membrane proteins, WIP3 may be subject to modifications that regulate its stability, localization, or interaction with binding partners.

  • Protein quality control: As a tail-anchored membrane protein, WIP3 likely undergoes quality control during its biogenesis and membrane insertion, possibly involving chaperones like HSC70 family members .

  • Protein-protein interactions: The function of WIP3 is regulated through interactions with WPP-domain proteins and potentially other factors that affect its localization and activity.

Understanding these regulatory mechanisms could provide insights into how plants modulate nuclear envelope structure and function in response to developmental cues and environmental stresses.

How does WIP3 function relate to plant development and stress responses?

Research on related proteins suggests that WIP3 may play important roles in:

  • Cell division and expansion: Proper nuclear envelope organization is essential for cell division, and disruptions in WIP3 function may affect mitotic activity, similar to what has been observed with reduced expression of WPP protein family members, which causes decreased mitotic activity in roots of Arabidopsis .

  • Root development: The requirement for WIP proteins in RanGAP1 localization in root tip cells suggests a particular importance in actively dividing tissues like root meristems .

  • Stress responses: Nuclear envelope integrity and nucleocytoplasmic transport are important for plant responses to various stresses, suggesting potential roles for WIP3 in stress adaptation.

Further research is needed to fully elucidate the specific contributions of WIP3 to these processes and how they differ from or overlap with the functions of other WIP family members.

What are optimal protocols for recombinant WIP3 expression?

For successful recombinant expression of Arabidopsis thaliana WIP3:

Bacterial Expression System (E. coli):

  • Clone the WIP3 coding sequence into an appropriate expression vector (pET, pGEX)

  • Consider expressing without the transmembrane domain to improve solubility

  • Optimize induction conditions (temperature, IPTG concentration, duration)

  • Use specialized E. coli strains (BL21(DE3) pLysS, Rosetta) to address potential codon bias issues

  • Include appropriate fusion tags (His, GST, MBP) to facilitate purification and improve solubility

Plant Expression Systems:

  • For transient expression in Nicotiana benthamiana:

    • Clone WIP3 into a binary vector with a suitable promoter (35S)

    • Co-express with HSC70-1 or WPP domain proteins to prevent aggregation

    • Use Agrobacterium-mediated transformation for leaf infiltration

    • Harvest tissue 48-72 hours post-infiltration

  • For stable expression in Arabidopsis:

    • Consider using native promoter constructs for physiologically relevant expression levels

    • Fluorescent protein fusions (GFP, mCherry) should be carefully designed to avoid interfering with the transmembrane domain

What approaches are effective for studying WIP3 protein-protein interactions?

Several complementary approaches can be used to study WIP3 interactions:

In vivo approaches:

  • Co-immunoprecipitation (Co-IP):

    • Express tagged versions of WIP3 (e.g., HA-WIP3 or WIP3-GFP) in Arabidopsis or N. benthamiana

    • Immunoprecipitate using tag-specific antibodies

    • Detect interacting partners by Western blot or mass spectrometry

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse WIP3 and potential interaction partners to complementary fragments of a fluorescent protein

    • Co-express in plant cells and visualize interaction by fluorescence microscopy

  • Tandem Affinity Purification (TAP):

    • Generate plants expressing TAP-tagged WIP3

    • Perform sequential affinity purification steps

    • Identify interacting proteins by mass spectrometry

In vitro approaches:

  • Yeast Two-Hybrid (Y2H):

    • Use truncated versions without the transmembrane domain

    • Verify positive interactions with alternative methods

  • Pull-down assays:

    • Express recombinant WIP3 with affinity tags

    • Incubate with plant extracts or purified potential interactors

    • Detect bound proteins by Western blot

What techniques are available for visualizing WIP3 subcellular localization?

Fluorescent Protein Fusion Approaches:

  • Stable transgenic lines:

    • Generate Arabidopsis plants expressing WIP3-FP fusions (preferably under native promoter)

    • Examine localization in different tissues and developmental stages

    • Consider both N-terminal and C-terminal fusions to assess potential effects on targeting

  • Transient expression:

    • Agrobacterium-mediated expression in N. benthamiana leaves

    • Co-express with HSC70-1 or WPP domain proteins to prevent aggregation

    • Visualize 2-3 days post-infiltration

Immunolocalization Approaches:

  • Antibody-based detection:

    • Develop specific antibodies against WIP3 or use antibodies against epitope tags

    • Perform immunofluorescence on fixed Arabidopsis tissues

    • Include appropriate controls to confirm specificity

Imaging Considerations:

  • Confocal microscopy is essential for accurate determination of nuclear envelope localization

  • Co-localization with known nuclear envelope markers helps confirm precise localization

  • Live-cell imaging allows tracking of dynamic behavior

  • Super-resolution microscopy (STORM, PALM) provides enhanced resolution of nuclear envelope structures

What genetic tools are available for studying WIP3 function?

Mutant Resources:

  • T-DNA insertion lines:

    • Available from stock centers (ABRC, NASC)

    • Screen for homozygous mutants by PCR-based genotyping

    • Verify loss of expression by RT-PCR or Western blot

  • CRISPR/Cas9 gene editing:

    • Design guide RNAs targeting specific regions of WIP3

    • Generate precise mutations or deletions

    • Create higher-order mutants by targeting multiple WIP family genes simultaneously

Transgenic Approaches:

  • Complementation studies:

    • Transform wip3 mutants with wild-type or modified WIP3 constructs

    • Assess rescue of mutant phenotypes

  • Overexpression studies:

    • Express WIP3 under constitutive or inducible promoters

    • Analyze phenotypic consequences of elevated WIP3 levels

  • Dominant negative approaches:

    • Express truncated or mutated versions of WIP3 that interfere with endogenous function

    • Particularly useful for studying proteins with potential redundancy

How can researchers validate WIP3 function in planta?

Molecular and Biochemical Validation:

  • Protein complex analysis:

    • Isolate nuclear envelopes and analyze protein composition

    • Compare WIP3-associated protein complexes between wild-type and mutant plants

  • Functional complementation:

    • Test ability of WIP3 to rescue phenotypes of wip3 mutants

    • Assess cross-complementation with other WIP family members

    • Introduce specific mutations to determine critical functional domains

  • Expression profiling:

    • Analyze transcriptome changes in wip3 mutants

    • Identify pathways affected by WIP3 dysfunction

What are common challenges in working with recombinant WIP3?

Researchers working with recombinant WIP3 often encounter several key challenges:

  • Protein aggregation: As a membrane protein, WIP3 has hydrophobic regions that can cause aggregation when overexpressed. This is similar to what has been observed with related proteins like WIT1, which forms large cytoplasmic aggregates when overexpressed in N. benthamiana leaf epidermis cells .

    Solution: Co-express with molecular chaperones like HSC70-1 or WPP-domain proteins, which have been shown to significantly reduce aggregation of related proteins . Consider expressing truncated versions lacking the transmembrane domain for some applications.

  • Proper folding: Ensuring correct folding of the coiled-coil domain is essential for functional studies.

    Solution: Express at lower temperatures (16-20°C) and consider adding folding enhancers to the culture medium. Using fusion partners like MBP that enhance solubility can also improve folding outcomes.

  • Membrane targeting: For functional studies, proper targeting to membranes is crucial.

    Solution: When expressing full-length WIP3, ensure the C-terminal transmembrane domain remains accessible. For in vitro studies requiring membrane association, consider incorporating the protein into liposomes or nanodiscs.

How can researchers differentiate the functions of WIP3 from other WIP family members?

Given the potential functional redundancy among WIP family proteins, researchers can employ several strategies to distinguish WIP3-specific functions:

  • Comparative phenotypic analysis:

    • Generate and characterize single, double, and triple mutants of WIP family members

    • Look for phenotypes that are specific to or more severe in wip3 mutants

    • Perform complementation studies with different WIP proteins

  • Domain swap experiments:

    • Create chimeric proteins by exchanging domains between WIP3 and other WIP family members

    • Express these chimeras in appropriate mutant backgrounds

    • Determine which domains confer specific functions

  • Differential expression analysis:

    • Compare expression patterns of WIP genes across tissues, developmental stages, and conditions

    • Identify contexts where WIP3 is uniquely or predominantly expressed

    • Focus functional studies on these specific contexts

  • Interaction partner specificity:

    • Conduct comparative interaction studies to identify WIP3-specific binding partners

    • Use these specific interactions as readouts for WIP3 function

What are emerging areas for WIP3 research?

Several promising research directions for WIP3 include:

  • Structural biology approaches:

    • Determination of the 3D structure of WIP3, particularly its coiled-coil domain

    • Structural analysis of WIP3 in complex with WPP-domain proteins

    • Comparison with structures of other WIP family members

  • Systems biology integration:

    • Placement of WIP3 function within broader nuclear envelope protein networks

    • Investigation of how WIP3 function integrates with nucleocytoplasmic transport pathways

    • Exploration of potential roles in signaling networks connecting the nuclear envelope to cellular responses

  • Evolutionary perspectives:

    • Comparative analysis of WIP proteins across plant species

    • Investigation of how the WIP-based nuclear targeting system evolved in plants

    • Identification of functional innovations in different plant lineages

  • Roles in plant stress responses:

    • Examination of WIP3 function under various abiotic and biotic stresses

    • Investigation of potential stress-specific regulation of WIP3 expression or localization

    • Exploration of engineering opportunities to enhance plant stress resilience through WIP3 modification

How might advanced imaging techniques advance our understanding of WIP3?

Cutting-edge imaging approaches offer new opportunities for WIP3 research:

  • Super-resolution microscopy:

    • Techniques like STORM, PALM, or SIM can reveal previously unresolvable details of WIP3 organization at the nuclear envelope

    • Multi-color approaches can map precise spatial relationships between WIP3 and interaction partners

  • Live-cell imaging with enhanced sensors:

    • Development of improved fluorescent protein fusions or split fluorescent protein systems for visualizing WIP3 dynamics

    • Application of FRET-based sensors to monitor WIP3 interactions in real-time

    • Use of optogenetic tools to manipulate WIP3 function with spatial and temporal precision

  • Correlative light and electron microscopy (CLEM):

    • Integration of fluorescence imaging of WIP3 with high-resolution electron microscopy

    • Examination of WIP3's relationship to nuclear pore complexes and other nuclear envelope structures

  • Single-molecule tracking:

    • Analysis of the dynamic behavior of individual WIP3 molecules

    • Determination of diffusion rates, residence times, and interaction kinetics

These advanced imaging approaches will provide unprecedented insights into the dynamic behavior and functional organization of WIP3 at the nuclear envelope.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.