Recombinant Arabidopsis thaliana WPP domain-interacting tail-anchored protein 1 (WIT1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. Please inform us of any specific tag requirements; we will prioritize developing the specified tag.
Synonyms
WIT1; At5g11390; F2I11.280; WPP domain-interacting tail-anchored protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-703
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
WIT1
Target Protein Sequence
METETEHDRTVSVDDNDSLVPEPSSTKESFFEDLSLTGQVMNPQLSSAGEVLTKVELDFA FVSEKLVNLSLLTMQLGTRENDFESFVSKKEEDEEEPSSNVDDDDDSAEKALEFDLLSSI LNSEVKELESLLGFLQNEIQSARVMISPFQHDGEAFLDLEGKLNDTEQSLGQLMEQVVEM KKQSSNFQRLSSGLDEQGSWSGGQTSVSQNDGEFGDLSAKINMQTADQQRNVLRMLEKSL AKEMELEKKLSESRNTERELEMKLYSSEQDVVYMEEVTEDAFSRWLEADNAAEVFKGTSK EMSGKLQILQFNLSGSFKREDNLKSKLVDSKERLEAKECALHKLDSSNARLADFLVAQTE GLKESLQEAEEKLILLNTENSTLSEKVSSLEEQLNEYGIQTEDADATSGALITDLERINE ELKDKLAKTEARAEETESKCKILEESKKELQDELGNFRDKGFTIHKLASLEKHLRDSDLQ LEHAVAAVEASKEKQNLLYSTVSDMEDVIEDLKSKVLKAENRADITEEKLIMVSESNAEV NEELKFFKGRLKEGEKYLQQAEERKLRTAKDIGVHNKIMKKLVMQLAAERERLHKQITNL SRENCVLMVKLKKVGKTGYMESGNGSEVSPKSDQNASSCHQGSRLQATFISLTNPEEEET GSKSDIGSVRRLDVGALRFKHILVAILVILISSIAYVISQQNM
Uniprot No.

Target Background

Function
In conjunction with WIT2, this protein is necessary for the nuclear envelope docking of RANGAP proteins in root tips.
Gene References Into Functions
  1. HSC70-1 and WPP-domain proteins facilitate WIT1 nuclear envelope targeting. [WIT1] PMID: 19617588
Database Links

KEGG: ath:AT5G11390

STRING: 3702.AT5G11390.1

UniGene: At.27962

Subcellular Location
Nucleus envelope. Nucleus membrane; Single-pass membrane protein. Note=During cytokinesis, aggregates around nuclear pores at the cell plate.
Tissue Specificity
Ubiquitous.

Q&A

What is WIT1 and what is its significance in Arabidopsis thaliana?

WIT1 (WPP domain-interacting tail-anchored protein 1) is a plant-specific nuclear envelope-associated protein containing a coiled-coil domain and a C-terminal predicted transmembrane domain. It serves as a key component of the plant nuclear envelope architecture and is involved in nuclear positioning during development . WIT1, together with its homolog WIT2, forms complexes that are required for proper association of RanGAP1 (the GTPase-activating protein of the small GTPase Ran) with the nuclear envelope, particularly in root tips .

How is WIT1 structurally characterized?

WIT1 contains two primary structural domains:

  • A coiled-coil domain that mediates protein-protein interactions

  • A C-terminal transmembrane domain (TMD) that anchors the protein to the nuclear envelope

This architecture classifies WIT1 as a tail-anchored (TA) protein, with functional domains facing the cytoplasm while being anchored to the membrane via its C-terminal region . The coiled-coil domain is particularly important for interactions with WPP-domain proteins.

What are the primary interaction partners of WIT1?

WIT1 has been confirmed to interact with several proteins in planta:

Interaction PartnerNature of InteractionFunctional Significance
WPP1 and WPP2Direct binding via WPP motifPrevents aggregation of WIT1's coiled-coil domain
HSC70-1Chaperone interactionPrevents aggregation and facilitates proper folding
RanGAP1Indirect via WPP proteinsNuclear envelope targeting of RanGAP1

These interactions have been demonstrated through multiple experimental approaches including co-immunoprecipitation and in vivo imaging studies .

How can researchers express and purify recombinant WIT1 for in vitro studies?

While the search results don't directly address recombinant WIT1 expression, standard approaches for membrane proteins can be applied:

  • Expression Systems:

    • Bacterial systems using E. coli with specialized strains designed for membrane proteins

    • Eukaryotic systems (yeast, insect cells) for proper folding and post-translational modifications

  • Construct Design:

    • N-terminal tags (His, GST, MBP) positioned before the coiled-coil domain

    • Truncated constructs omitting the C-terminal TMD for improved solubility

    • Addition of solubility-enhancing tags for the full-length protein

  • Purification Strategy:

    • Mild detergent solubilization (DDM, LDAO) for full-length protein

    • IMAC purification followed by size exclusion chromatography

    • Quality control via circular dichroism and thermal shift assays

  • Reconstitution Methods:

    • Nanodisc incorporation for maintaining native-like membrane environment

    • Liposome reconstitution for functional studies

What microscopy techniques are most effective for studying WIT1 localization?

Based on successful approaches from the literature:

  • Live Cell Imaging:

    • Fluorescent protein fusions (GFP-WIT1) for localization studies

    • Time-lapse microscopy for dynamic processes during pollen tube growth

  • Interaction Analysis:

    • Bimolecular fluorescence complementation (BiFC) for in vivo interaction studies

    • FRET-based approaches for detecting proximity to other nuclear envelope proteins

  • Advanced Techniques:

    • FRAP (Fluorescence Recovery After Photobleaching) for mobility assessment

    • Super-resolution microscopy for detailed localization within the nuclear envelope

The choice of Nicotiana benthamiana leaf epidermis cells has proven particularly useful as a heterologous expression system for studying WIT1 localization and aggregation patterns .

How do WPP-domain proteins and HSC70-1 prevent WIT1 aggregation?

When expressed at high levels in Nicotiana benthamiana, WIT1 tends to form large fluorescent bodies in the cytoplasm that likely represent protein aggregates . Both WPP-domain proteins and HSC70-1 chaperone prevent this aggregation through complementary mechanisms:

  • WPP-domain proteins (WPP1 and WPP2):

    • Act specifically on the coiled-coil domain region of WIT1

    • Require intact WPP motif (tryptophan-proline-proline) for this activity

    • A WPP1 mutant with WPP→AAP substitution fails to prevent aggregation

    • The percentage of cells containing aggregates when co-expressing WPP1 WPP/AAP was 77%, compared to only 24% with wild-type WPP1

  • HSC70-1 chaperone:

    • Acts on both the coiled-coil domain and the C-terminal transmembrane domain

    • Provides a broader chaperone activity than WPP proteins

    • Significantly reduces GFP-WIT1 aggregation and permits association with the nuclear envelope

These findings suggest that proper targeting of WIT1 to the nuclear envelope requires both specific (WPP proteins) and general (HSC70-1) chaperone activities to prevent aggregation of different domains .

What is the function of WIT1 in pollen tube growth and fertilization?

WIT1 plays a critical role in nuclear positioning during pollen tube growth:

  • Nuclear Positioning:

    • In wild-type Arabidopsis, the vegetative nucleus enters the pollen tube before the sperm cells

    • WIT1/WIT2 are involved in the transport of the vegetative nucleus as KASH proteins located on the outer nuclear envelope

  • Mutant Phenotypes:

    • In wit1/wit2 double mutants, the relative positions of vegetative nucleus and sperm cells are inverted

    • The vegetative nucleus appears to be dragged by the sperm cells rather than leading the way

    • The double mutant shows defects in discharging pollen-tube contents into synergid cells

  • Functional Implications:

    • WIT1/WIT2-dependent nuclear positioning appears to be essential for proper fertilization

    • The phenotype suggests the existence of a KASH-independent transport mechanism for sperm cells

    • Time-lapse movies show that sperm nuclei actively move in the pollen grain even in wit1/wit2 mutant background

This function represents a specialized role of WIT1 in reproductive development that is distinct from its general nuclear envelope functions.

How does WIT1 compare to nuclear envelope proteins in other organisms?

WIT1 represents a plant-specific adaptation of the nuclear envelope architecture:

This evolutionary divergence highlights the importance of studying plant-specific nuclear envelope proteins to understand unique aspects of plant cell biology.

How can genetic approaches be optimized to study WIT1 function?

Several genetic approaches have proven effective for studying WIT1:

  • Mutant Analysis:

    • Single and double mutant comparisons (wit1, wit2, wit1/wit2) reveal functional redundancy

    • Hemizygous plants with different genetically linked transgenes allow for complex phenotypic analysis

  • Transgenic Approaches:

    • Fluorescent protein tagging for localization studies

    • Complementation studies with truncated or mutated versions to identify functional domains

    • Tissue-specific expression to determine localized functions

  • Advanced Genetic Tools:

    • CRISPR/Cas9 for precise genome editing

    • Artificial microRNAs for targeted knockdown

    • Inducible expression systems for temporal control

The choice of genetic background is particularly important, as demonstrated by studies using the SC-cal RHT hemizygous plants in the wit1/wit2 background to study nuclear positioning defects .

What methods are best for studying protein-protein interactions involving WIT1?

Based on successful approaches in the literature:

  • In Vivo Techniques:

    • Co-immunoprecipitation has successfully identified interactions between WIT1, WPP-domain proteins, and HSC70-1

    • Bimolecular fluorescence complementation for visualizing interactions in live cells

    • FRET-based approaches for detecting proximity relationships

  • In Vitro Methods:

    • Pull-down assays with recombinant proteins

    • Surface plasmon resonance for quantitative binding analysis

    • Isothermal titration calorimetry for thermodynamic parameters

  • High-Throughput Approaches:

    • Yeast two-hybrid screening for identifying novel interaction partners

    • Proximity-dependent biotin identification (BioID) for mapping interaction networks

    • Mass spectrometry of immunoprecipitated complexes

A combination of these approaches provides the most comprehensive understanding of WIT1's interaction network.

What are the experimental challenges in studying WIT1 and how can they be overcome?

Several challenges are associated with studying WIT1:

ChallengeSolution Strategy
Protein aggregation when overexpressedCo-express with WPP proteins and HSC70-1 chaperones
Membrane protein purification difficultiesUse specialized detergents and membrane mimetics
Functional redundancy with WIT2Study double mutants; use tissue-specific approaches
Dynamic nature of nuclear envelopeEmploy live-cell imaging with high temporal resolution
Low expression levels of endogenous proteinUse sensitive detection methods; consider endogenous tagging

Researchers have successfully addressed these challenges through careful experimental design, as demonstrated by studies using Nicotiana benthamiana as a heterologous expression system combined with appropriate controls and quantitative analysis .

What aspects of WIT1 function remain poorly understood?

Despite significant advances in WIT1 research, several important questions remain:

  • Structural details of WIT1 and its interaction interfaces with WPP proteins and HSC70-1

  • Regulatory mechanisms controlling WIT1 expression, localization, and function during development

  • Tissue-specific functions beyond pollen tube growth and root tips

  • Stress-responsive roles, if any, in modulating nuclear envelope functions during environmental challenges

  • Evolutionary relationships between WIT proteins across diverse plant species

Addressing these knowledge gaps will require interdisciplinary approaches combining structural biology, genetics, cell biology, and evolutionary analysis.

How might WIT1 research contribute to broader understanding of plant nuclear dynamics?

WIT1 research has significant implications for understanding:

  • Nuclear architecture in plant cells and how it differs from animal systems

  • Reproductive biology mechanisms specific to plants

  • Protein quality control systems for nuclear envelope proteins

  • Evolutionary adaptations of nuclear envelope functions in plants

  • Developmental regulation of nuclear positioning and movement

By continuing to investigate WIT1 and related proteins, researchers can gain fundamental insights into plant-specific aspects of nuclear envelope biology that may have agricultural and biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.