Recombinant Arabidopsis thaliana WPP domain-interacting tail-anchored protein 2 (WIT2)

Shipped with Ice Packs
In Stock

Description

Introduction to WIT2

WIT2 (At1g68910) is a plant-unique protein identified in Arabidopsis thaliana that belongs to a family of nuclear envelope-associated proteins known as WPP domain-interacting tail-anchored proteins (WITs) . The full-length protein consists of 627 amino acid residues and is encoded by the WIT2 gene located on chromosome 1 of Arabidopsis thaliana . WIT2, along with its homolog WIT1 (At5g11390), was first identified through tandem affinity purification coupled with mass spectrometry as interacting partners of WPP domain proteins . These proteins derive their name from their ability to interact with the WPP domain, which is characterized by a highly conserved tryptophan-proline-proline motif present in RanGAP (Ran GTPase-activating protein) and other WPP-containing proteins .

The identification of WIT proteins revealed a novel mechanism for nuclear envelope targeting in plants, which differs significantly from the nuclear envelope targeting mechanisms found in animals and fungi. Unlike in animals, where RanGAP targeting to the nuclear envelope involves direct interaction with the nucleoporin RanBP2/Nup358, plants appear to utilize a more complex system involving WIT proteins and another family of proteins called WIPs (WPP domain-interacting proteins) .

Domain Organization

WIT2 is characterized by two primary structural domains:

  1. Extended Coiled-Coil Domain: A predominant feature of WIT2 is its long predicted coiled-coil domain, which occupies a significant portion of the protein . Coiled-coil domains typically mediate protein-protein interactions and are often involved in the formation of protein complexes.

  2. C-Terminal Transmembrane Domain: The C-terminal region of WIT2 contains a putative transmembrane domain that anchors the protein to the nuclear membrane . This feature classifies WIT2 as a tail-anchored protein, with most of the protein facing the cytoplasm while being anchored to the membrane by its C-terminus.

The domain organization of WIT2 is similar to that of the WIP family proteins, though they represent distinct protein families with different interaction patterns and specific functions . This structural similarity suggests potential functional convergence in nuclear envelope biology.

Functional Roles of WIT2

WIT2 performs several critical functions in plant cells, particularly in the context of nuclear envelope biology and protein targeting.

Role in Nuclear Envelope Targeting

One of the primary functions of WIT2, along with WIT1, is to facilitate the association of RanGAP1 with the nuclear envelope in root tip cells of Arabidopsis . RanGAP is a key regulator of nucleocytoplasmic transport, and its proper localization at the nuclear envelope is essential for its function.

Unlike in animal cells, where RanGAP targeting to the nuclear envelope involves direct interaction with the nucleoporin RanBP2/Nup358 (which is absent in plants), plant RanGAP targeting depends on WIT proteins and another family of proteins called WIPs . This represents a fundamental difference in nuclear envelope biology between plants and animals.

Tissue-Specific Functions

Interestingly, the requirement for WIT proteins in RanGAP targeting appears to be tissue-specific. While WIT proteins are essential for RanGAP association with the nuclear envelope in root tip cells, they are dispensable in other plant tissues . This suggests a specialized role for WIT proteins in certain cell types, possibly reflecting differences in nuclear envelope dynamics or protein targeting mechanisms across different plant tissues.

Protein-Protein Interactions

WIT2 participates in a complex network of protein interactions that underlie its function in nuclear envelope biology.

Interaction with WPP Domain Proteins

WIT proteins, including WIT2, interact with members of the WPP protein family, which includes WPP1, WPP2, and the WPP domain-containing RanGAP proteins . While the specific interaction between WIT2 and WPP proteins hasn't been detailed in the provided search results, its homolog WIT1 has been shown to interact with WPP1 and WPP2 in planta .

Yeast two-hybrid assays have demonstrated that WIT1 interacts with WPP1, WPP2, full-length RanGAP1, RanGAP2, and the WPP domain of RanGAP1, but not with WPP3 or the C-terminal region of RanGAP1 without the WPP domain . Given the structural similarity between WIT1 and WIT2, it is likely that WIT2 exhibits similar interaction patterns.

Role in Preventing Protein Aggregation

Studies on WIT1 have shown that when overexpressed, it tends to form aggregates in the cytoplasm. Co-expression with WPP1, WPP2, or the chaperone HSC70-1 prevents this aggregation and enables proper localization of WIT1 to the nuclear envelope . While this has been demonstrated specifically for WIT1, the structural similarity between WIT1 and WIT2 suggests that WIT2 might behave similarly and may also be subject to chaperone-mediated regulation to prevent aggregation.

Recombinant WIT2 Production and Properties

The production of recombinant WIT2 protein has facilitated research into its structure, function, and interactions. The recombinant protein provides a valuable tool for in vitro studies and allows for detailed biochemical and structural analyses.

Expression and Purification

Recombinant full-length Arabidopsis thaliana WIT2 protein (amino acids 1-627) can be produced with an N-terminal His tag using an E. coli expression system . The His tag facilitates purification of the protein using affinity chromatography, allowing for the production of relatively pure protein for research purposes.

The following table summarizes the properties of the recombinant WIT2 protein:

PropertyDescription
SpeciesArabidopsis thaliana
SourceE. coli
TagHis (N-terminal)
Protein LengthFull Length (1-627 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE

Study of Nuclear Envelope Dynamics

Recombinant WIT2 protein serves as a valuable tool for studying the unique mechanisms of nuclear envelope targeting in plants. By understanding the interactions between WIT2 and its binding partners, researchers can gain insights into the plant-specific aspects of nuclear envelope biology that differ from the better-studied systems in animals and fungi .

Investigation of Protein-Protein Interactions

The recombinant WIT2 protein can be used in various in vitro assays to study its interactions with WPP domain proteins, RanGAP, and other potential binding partners. These studies can help elucidate the molecular mechanisms underlying nuclear envelope targeting in plants and the tissue-specific variations in these processes .

Comparison with Related Proteins

Comparative studies between WIT2 and other related proteins, such as WIT1 and WIP family proteins, can provide insights into the evolution and diversification of nuclear envelope targeting mechanisms in plants. Such studies can help identify conserved and divergent features that contribute to the specialized functions of these proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
WIT2; At1g68910; T6L1.9; WPP domain-interacting tail-anchored protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-627
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
WIT2
Target Protein Sequence
MEEIIREDYFEALSSRNEEEQEMLRMLTKLEIDSAYTSEKLMNLHVLLMHLLAWDNDLEG MGTLDSSPASFEKALTFDLLCGILESEVKEVDEVLDVLEAQIVDTSYKISSCKHGNYIVI EGKLGESAESLKQSRGQVSEITLQLAQLRRTLHYIRNGTSENEESVELRQKYALKPSDLR HKNALRMLEKSLSRELELEKKLMEFQQNEEQLKLKLHYTEEVSSRMEEASEFIWGRFLEA DNSSEVLTGISKELVGRLQILQFSLNGSAQRESELKSKLEDCTVQLEAKDLLVQKLEGTI SENSEIVSEVLTLREYVKSAEQKLKNTDLELKSVNASKQEILVHLAEMENANESVKENLF EAESRAESGEAKIKELDAANLELTEELNFLKDADDKKTKKVNSLEKQVRELEVQVQNSKV SSEANQEQQNMLYSAIWDMETLIEDLKSKASKAESRTETVEEQCIVLSTTNSELNKDVSF LRQKAKSLEAMLDLANNEKERYAQEITTRNKVLMDMMLQLSSERERIQEQLYSLAKENKI LRVNQCSNTYQRNGSYAGDKELSFHADGHEIEALAESLQEDERTREEPEKQSVSEKSSEI RRAIKLKHILVVALVFVLFCSFFGVTY
Uniprot No.

Target Background

Function
WIT2, in conjunction with WIT1, is essential for nuclear envelope docking of RANGAP proteins in root tips. It plays a crucial role in nuclear shape determination. As a component of the SUN-WIP-WIT2-KAKU1 complex, it facilitates the transmission of cytoplasmic forces to the nuclear envelope (NE), thereby influencing nuclear morphology.
Database Links

KEGG: ath:AT1G68910

STRING: 3702.AT1G68910.1

UniGene: At.35468

Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Ubiquitous.

Q&A

What is the molecular structure of WIT2 and how does it compare to WIT1?

WIT2, like its homolog WIT1, is an Arabidopsis protein containing a coiled-coil domain and a C-terminal predicted transmembrane domain. Both proteins function as tail-anchored proteins localized to the nuclear envelope . The coiled-coil domain is particularly important for protein-protein interactions, while the transmembrane domain anchors the protein to the nuclear membrane. Structurally, WIT2 shares significant sequence homology with WIT1, though specific differences in their coiled-coil domains may account for subtle functional specializations .

The transmembrane domain of WIT proteins is particularly crucial for their localization, as demonstrated in studies with WIT1 where HSC70-1 chaperone acts on this domain to prevent protein aggregation and ensure proper nuclear envelope targeting . Both WIT1 and WIT2 are required for the association of RanGAP1 (the GTPase activating protein of the small GTPase Ran) with the nuclear envelope, particularly in root tips .

How do WPP domain proteins interact with WIT2 and what functional significance does this have?

WPP domain proteins (WPP1 and WPP2) bind to WIT2 in planta, similar to their demonstrated interaction with WIT1 . This binding occurs through the coiled-coil domain of WIT proteins. These interactions form part of a larger protein complex that regulates nuclear envelope architecture and function. Functionally, these interactions are critical for:

  • Anchoring RanGAP1 to the nuclear envelope

  • Maintaining proper nuclear shape and positioning

  • Facilitating nucleocytoplasmic transport processes

Studies with WIT1 have shown that WPP1 and WPP2 can prevent protein aggregation and facilitate proper nuclear envelope targeting, activities that are likely conserved with WIT2 . WPP proteins accomplish this by acting on regions containing the coiled-coil domain, which suggests a chaperone-like function that ensures proper folding and localization of WIT proteins.

What roles do WIT2 and associated proteins play in nuclear envelope structure?

WIT2 is part of the SUN-WIP-WIT nuclear envelope protein complex that independently determines plant nuclear shape . This complex consists of:

  • SUN domain proteins (inner nuclear membrane)

  • WPP-interacting proteins (WIPs)

  • WPP domain-interacting tail-anchored proteins (WITs)

Together with WIT1, WIT2 functions at the outer nuclear membrane to anchor RanGAP1 to the nuclear envelope, particularly in root tips . This anchoring is crucial for proper Ran-dependent nucleocytoplasmic transport. The interaction between WIT2 and WPP proteins is part of a larger network that maintains nuclear envelope integrity and regulates nuclear positioning and shape.

Nuclear envelope proteins like WIT2 are increasingly recognized as critical factors in plant development and stress responses, as they affect gene expression by influencing chromatin organization and nucleocytoplasmic trafficking of regulatory proteins.

What are the optimal expression systems and conditions for producing recombinant WIT2?

For recombinant expression of WIT2, several expression systems can be considered, each with specific advantages:

E. coli Expression System:

  • Use BL21(DE3) strain for high-yield expression

  • Express as a fusion protein with tags like His6, GST, or MBP to improve solubility

  • Optimal induction conditions: 0.1-0.5 mM IPTG at 16-18°C for 16-20 hours

  • Include protease inhibitors during protein extraction

  • Consider co-expression with molecular chaperones to prevent aggregation

Plant-Based Expression Systems:

  • For more native post-translational modifications, use Nicotiana benthamiana transient expression

  • Use Arabidopsis-optimized codons for improving expression levels

  • Consider using strong promoters like 35S for high expression

  • Include molecular chaperones like HSC70-1 to prevent aggregation

Aggregation Prevention:
Based on studies with WIT1, co-expression with HSC70-1 significantly reduces protein aggregation and improves proper localization . This strategy should be considered when expressing recombinant WIT2, particularly when studying its functional interactions.

What in vivo imaging techniques are most effective for studying WIT2 localization and dynamics?

For effective visualization of WIT2 localization and dynamics in planta, consider the following approaches:

Fluorescent Protein Fusion:

  • Generate N-terminal GFP-WIT2 fusion constructs under native or 35S promoters

  • C-terminal fusions may interfere with the transmembrane domain function

  • When overexpressing GFP-WIT2, co-express HSC70-1 to prevent cytoplasmic aggregation

Advanced Microscopy Techniques:

  • Confocal laser scanning microscopy for standard localization studies

  • Fluorescence recovery after photobleaching (FRAP) to study protein dynamics

  • Förster resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) to study protein-protein interactions in vivo

Controls and Validation:

  • Include proper subcellular markers (nuclear envelope, ER, etc.)

  • Compare localization patterns with known interactors (WPP proteins, RanGAP1)

  • Use multiple independent transgenic lines to rule out positional effects

Studies with WIT1 demonstrated that GFP-WIT1 localizes to the nuclear envelope in Arabidopsis but forms cytoplasmic aggregates when overexpressed in N. benthamiana unless co-expressed with HSC70-1 . Similar considerations should be applied when imaging WIT2.

How can protein-protein interactions involving WIT2 be effectively studied?

Several complementary approaches can be employed to study WIT2 interactions:

In Vitro Methods:

  • Pull-down assays using recombinant proteins

  • Surface plasmon resonance (SPR) for quantitative binding kinetics

  • Isothermal titration calorimetry (ITC) for thermodynamic parameters

In Vivo Methods:

  • Co-immunoprecipitation with specific antibodies

  • Yeast two-hybrid screening for novel interactors

  • Split-GFP complementation assays in planta

  • FRET/FLIM for studying interactions in live cells

Domain Mapping:

  • Generate truncated versions of WIT2 focusing on:

    • Coiled-coil domain (interacts with WPP proteins)

    • C-terminal transmembrane domain (interacts with HSC70-1)

  • Perform site-directed mutagenesis of key residues

Based on studies with WIT1, interactions with WPP proteins and HSC70-1 are likely mediated through distinct domains, with WPP proteins acting on the coiled-coil region and HSC70-1 interacting with both the coiled-coil domain and the C-terminal transmembrane domain .

What phenotypic analyses are most informative when studying WIT2 mutants?

When characterizing WIT2 mutant plants, several phenotypic analyses can provide valuable insights:

Cellular-Level Analyses:

  • Nuclear positioning and shape analysis in root tips using confocal microscopy

  • RanGAP1 localization studies (expected to show nuclear envelope targeting defects)

  • Nuclear envelope integrity assessments

Developmental Phenotyping:

  • Root development analysis (primary root length, lateral root formation)

  • Analysis of above-ground architecture (stem morphology, leaf development)

  • Reproductive development assessment (flowering time, silique development)

Stress Response Evaluation:

  • Response to mechanical stress (which often affects nuclear positioning)

  • Heat stress response (particularly relevant given the HSC70-1 interaction )

  • Sensitivity to DNA damaging agents (due to potential impacts on nuclear function)

When interpreting phenotypic data, it's important to consider potential functional redundancy between WIT1 and WIT2. Studies should include single and double mutants to assess overlapping and distinct functions.

How can the functional relationship between WIT2, WPP proteins, and HSC70-1 be experimentally dissected?

To understand the functional relationships in this protein network:

Genetic Approaches:

  • Generate single, double, and triple mutants of WIT1, WIT2, WPP1, WPP2, and HSC70-1

  • Create complementation lines expressing truncated or mutated versions of these proteins

  • Use inducible expression systems to study temporal aspects of these interactions

Biochemical Approaches:

  • Perform reciprocal co-immunoprecipitations to determine interaction dependencies

  • Use size exclusion chromatography to study complex formation

  • Employ cross-linking mass spectrometry to map interaction interfaces

Functional Assays:

  • Assess nuclear envelope targeting of RanGAP1 in various genetic backgrounds

  • Study protein aggregation prevention activity of WPP proteins and HSC70-1

  • Analyze nuclear transport efficiency using fluorescent reporters

Research with WIT1 has established that both WPP proteins and HSC70-1 can reduce protein aggregation and promote nuclear envelope association, suggesting a chaperone-like function for these proteins . Similar experiments with WIT2 would help determine if these functions are conserved.

What considerations are important when interpreting data from heterologous expression of WIT2?

When interpreting data from heterologous expression studies of WIT2:

Expression System Influences:

  • E. coli expression may lack post-translational modifications present in planta

  • Yeast systems may provide eukaryotic modifications but could still differ from plants

  • Non-Arabidopsis plant expression systems (e.g., N. benthamiana) may show differences in protein processing or localization

Localization Pattern Analysis:

  • GFP-WIT2 may form cytoplasmic aggregates when overexpressed in heterologous systems

  • Co-expression with HSC70-1 can help prevent aggregation

  • The presence/absence of compatible interaction partners in the heterologous system will affect localization

Functional Conservation Assessment:

  • Compare WIT2 function across species to determine evolutionary conservation

  • Consider the presence of species-specific interactors

  • Evaluate whether experimental results align with known functions in Arabidopsis

Research with WIT1 showed significant differences in localization patterns between Arabidopsis (nuclear envelope) and transiently transformed N. benthamiana (cytoplasmic aggregates unless co-expressed with HSC70-1) . These findings highlight the importance of cellular context when interpreting heterologous expression data for nuclear envelope proteins like WIT2.

How can WIT2 research contribute to our understanding of nuclear organization in plants?

WIT2 research provides insights into fundamental aspects of plant nuclear organization:

Nuclear Envelope Protein Networks:

  • WIT2 is part of the SUN-WIP-WIT complex that determines nuclear shape and positioning

  • Understanding WIT2 function helps elucidate how the outer nuclear membrane connects to cytoskeletal elements

  • These connections influence nuclear movement during processes like cell division and defense responses

Nuclear Transport Regulation:

  • WIT2's role in anchoring RanGAP1 to the nuclear envelope impacts Ran-dependent nucleocytoplasmic transport

  • This transport is crucial for gene expression regulation, particularly during development and stress responses

Evolutionary Perspective:

  • Comparing WIT2 function across plant species can reveal evolutionary adaptations in nuclear organization

  • This contributes to understanding plant-specific aspects of nuclear envelope architecture that differ from animal systems

WIT2 research connects to broader themes in plant biology, including stress responses, development, and gene expression regulation, all of which depend on proper nuclear organization and function.

What does current research reveal about the relationship between WIT2 and plant stress responses?

While specific information about WIT2's role in stress responses is limited in the provided search results, research on nuclear envelope proteins suggests several potential mechanisms:

Nuclear Positioning During Stress:

  • As part of the nuclear envelope protein complex, WIT2 likely influences nuclear positioning during stress responses

  • Proper nuclear positioning is crucial for cellular responses to biotic and abiotic stresses

Nucleocytoplasmic Transport Regulation:

  • WIT2's involvement in RanGAP1 anchoring affects protein and RNA transport between nucleus and cytoplasm

  • This transport is often altered during stress responses to modify gene expression patterns

Potential Heat Stress Connection:

  • The interaction between WIT2 and heat shock cognate protein HSC70-1 suggests a possible role in heat stress responses

  • HSC70-1 functions as a molecular chaperone, preventing protein aggregation under stress conditions

Future research should focus on comparing wild-type and WIT2 mutant plants under various stress conditions to fully elucidate its role in stress adaptation.

How can findings from Arabidopsis WIT2 research be translated to crop improvement?

Translating WIT2 research from Arabidopsis to crops involves several considerations:

Identifying Crop Orthologs:

  • Identify and characterize WIT2 orthologs in major crop species

  • Compare sequence conservation, especially in functional domains

  • Assess expression patterns across tissues and developmental stages

Functional Conservation Testing:

  • Determine if crop WIT2 orthologs perform similar functions in nuclear organization

  • Test complementation of Arabidopsis wit2 mutants with crop orthologs

  • Analyze nuclear envelope structure and function in crop species

Potential Agricultural Applications:

  • Modifying nuclear positioning may enhance stress resilience

  • Altered nucleocytoplasmic transport could influence developmental programs relevant to yield

  • Engineering WIT2 expression might affect cellular responses to environmental cues

Arabidopsis serves as an excellent model for translational research due to its well-characterized genome and extensive molecular tools . Research on WIT2 in Arabidopsis can provide foundational knowledge that accelerates discoveries in crop species, particularly for complex traits related to nuclear function and organization.

How does WIT2 function compare across different plant species?

Comparative analysis of WIT2 across plant species reveals important evolutionary patterns:

Conservation Patterns:

  • WIT proteins appear to be plant-specific nuclear envelope components

  • Functional domains (coiled-coil and transmembrane) show different degrees of conservation

  • WIT-WPP interactions are likely conserved across plant species

Functional Adaptations:

  • Species-specific modifications may reflect adaptations to different environmental conditions

  • Expression patterns and tissue specificity can vary between species

  • Interaction networks may include species-specific components

Methodological Approach:

  • Phylogenetic analysis of WIT2 sequences across plant species

  • Complementation studies using WIT2 from different species

  • Comparative localization studies in heterologous expression systems

The plant-specific nature of WIT proteins highlights their unique role in plant nuclear organization, making them interesting subjects for evolutionary studies on plant-specific cellular adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.