Recombinant Arabidopsis thaliana Xyloglucan glycosyltransferase 4 (CSLC4)

Shipped with Ice Packs
In Stock

Description

Functional Role in Xyloglucan Biosynthesis

CSLC4 catalyzes the formation of β-1,4-linked glucan chains, which serve as the backbone for XyG. Key findings include:

  • Genetic Evidence: Quintuple cslc mutants (cslc4/5/6/8/12) in Arabidopsis lack detectable XyG, confirming CSLC4's essential role in XyG biosynthesis .

  • Enzymatic Activity: Heterologous expression in Pichia pastoris demonstrated that recombinant CSLC4 produces β-1,4-glucan oligomers (DP4–DP6) . Coexpression with xylosyltransferases (e.g., XXT1) enhances glucan chain elongation, suggesting cooperative interactions .

  • Subcellular Localization: CSLC4 localizes to the Golgi apparatus, where XyG biosynthesis occurs .

Membrane Topology

CSLC4 is an integral membrane protein with six transmembrane domains (TMDs) . Its catalytic domain faces the cytosol, enabling UDP-glucose utilization from the cytoplasmic pool . This orientation contrasts with other Golgi-localized glycosyltransferases, which typically have lumen-facing active sites .

Domain Organization

  • Catalytic Domain: Located between TMDs 2 and 3 .

  • Conserved Motifs: Shares GT-A fold motifs common to CAZy GT family 2 enzymes .

In Vitro Studies

  • Heterologous Expression: Recombinant CSLC4 expressed in E. coli or P. pastoris produces soluble β-1,4-glucans, confirmed by HPAEC and mass spectrometry .

  • Protein-Protein Interactions: CSLC4 forms homocomplexes and interacts with xylosyltransferases (XXT1, XXT2, XXT5) via bimolecular fluorescence complementation (BiFC) assays, suggesting a multiprotein synthesis complex .

In Vivo Studies

  • Mutant Phenotypes: Arabidopsis cslc4 single mutants show normal growth, but higher-order mutants exhibit reduced XyG levels and mild developmental defects .

  • Complementation: All five CSLC genes (CSLC4/5/6/8/12) can rescue XyG deficiency in the quintuple mutant, indicating functional redundancy .

Applications in Research

  • Mechanistic Studies: Used to investigate XyG biosynthesis pathways and enzyme cooperativity .

  • Plant Cell Wall Engineering: Insights from CSLC4 mutants inform strategies to modify cell wall composition for bioenergy crops .

  • Structural Biology: Serves as a model for studying membrane-bound glycosyltransferases .

Evolutionary and Phylogenetic Insights

CSLC4 is part of an ancient gene family conserved across land plants. Phylogenetic analyses reveal four clades within the CSLC family, with CSLC4 clustering in clade 2 alongside monocot and eudicot orthologs .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please specify them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CSLC4; At3g28180; MIG10.8; Xyloglucan glycosyltransferase 4; Cellulose synthase-like protein C4; AtCslC4; Xyloglucan synthase 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-673
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
CSLC4
Target Protein Sequence
MAPNSVAVTMEKPDNFSLLEINGSDPSSFPDKRKSISPKQFSWFLLLKAHRLISCLSWLV SSVKKRIAFSAKNINEEEDPKSRGKQMYRFIKACLVISIIALSIEIVAHFKKWNLDLINR PSWEVYGLVEWSYMAWLSFRSDYIAPLVISLSRFCTVLFLIQSLDRLVLCLGCFWIKFKK IEPKLTEESIDLEDPSSFPMVLIQIPMCNEREVYEQSIGAASQLDWPKDRILIQVLDDSD DPNLQLLIKEEVSVWAEKGVNIIYRHRLIRTGYKAGNLKSAMTCDYVKDYEFVTIFDADF TPNPDFLKKTVPHFKGNPELGLVQARWSFVNKDENLLTRLQNINLCFHFEVEQQVNGVFL NFFGFNGTAGVWRIKALEESGGWLERTTVEDMDIAVRAHLNGWKFIYLNDVEVTCELPES YEAYKKQQHRWHSGPMQLFRLCLPSIIKSKISVWKKANLIFLFFLLRKLILPFYSFTLFC IILPLTMFIPEAELPLWIICYVPIFISLLNILPSPKSFPFLVPYLLFENTMSITKFNAMI SGLFQFGSAYEWVVTKKTGRSSESDLLAFAEKEEKLHRRNSESGLELLSKLKEQETNLVG QETVKKSLGGLMRPKNKKKTNMVFKKELGLAFLLLTAAARSFLSAHGLHFYFLLFQGLSF LVVGLDLIGEQIS
Uniprot No.

Target Background

Function
Beta-1,4-glucan synthase is primarily involved in the synthesis of the xyloglucan backbone rather than cellulose. It appears to function concurrently with xyloglucan 6-xylosyltransferase. Xyloglucan is a noncellulosic polysaccharide found in the plant cell wall, composed of a glucan backbone substituted with xylose, galactose, and fucose. It associates with other xyloglucan-synthesizing enzymes to form multiprotein complexes for xyloglucan synthesis within the Golgi apparatus.
Gene References Into Functions
  1. The supramolecular organization of the CSLC4, XXT1, XXT2, and XXT5 proteins in Arabidopsis protoplasts was investigated. PMID: 22665445
  2. CSLA9 and CSLC4 localize to the Golgi apparatus and have opposite membrane orientations. PMID: 21143682
Database Links

KEGG: ath:AT3G28180

STRING: 3702.AT3G28180.1

UniGene: At.23682

Protein Families
Glycosyltransferase 2 family, Plant cellulose synthase-like C subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in seedlings, roots, leaves, stems, flowers and seeds.

Q&A

What is the primary function of CSLC4 in Arabidopsis thaliana?

CSLC4 functions as a putative xyloglucan (XyG) glucan synthase, responsible for synthesizing the β-1,4-glucan backbone of xyloglucan. Experimental evidence has conclusively demonstrated that CSLC proteins, including CSLC4, are essential for xyloglucan biosynthesis in plants. The concomitant disruption of multiple CSLC genes reduces xyloglucan levels below detectable limits, confirming their fundamental role in polysaccharide synthesis . Heterologous expression studies have further supported CSLC4's role as the primary XyG glucan synthase in Arabidopsis .

How is CSLC4 expression distributed throughout Arabidopsis tissues?

CSLC4 exhibits a widespread expression pattern throughout Arabidopsis tissues. According to eFP Browser expression database analyses, CSLC4 is widely expressed in most plant tissues compared to other CSLC family members. It shows particularly high expression in root hairs, along with CSLC12 . This broad expression pattern aligns with the ubiquitous presence of xyloglucan in primary cell walls and suggests CSLC4 plays a fundamental role in cell wall synthesis across various tissues and developmental stages.

What is the relationship between CSLC4 and other enzymes in the xyloglucan biosynthesis pathway?

CSLC4 functions within a complex biosynthetic pathway involving multiple glycosyltransferases. While CSLC4 synthesizes the β-glucan backbone, xylosyltransferases like XXT1 and XXT2 add xylose residues to this backbone. Studies in heterologous expression systems have shown that coexpression of CSLC4 and XXT1 in Pichia cells resulted in increased polymerization of β-glucan compared to expression of CSLC4 alone . This suggests that CSLC4 and XXT1 interact, either directly or indirectly, to modulate β-glucan length and structure. The coordinated action of these enzymes is likely required to produce the characteristic XXXG repeating structure of xyloglucan found in plants .

What are the optimal expression systems for producing recombinant CSLC4?

For successful expression of functional recombinant CSLC4, mammalian cell culture systems have proven particularly effective. This approach has enabled the production of sufficient quantities of enzyme for advanced structural studies including X-ray crystallography . Alternatively, heterologous expression in Pichia pastoris has been successfully employed for functional studies, though it's important to note that Pichia lacks UDP-Xyl, which limits its ability to produce complete xyloglucan . When designing expression constructs, researchers should consider:

Expression SystemAdvantagesLimitationsApplications
Mammalian cellsPost-translational modifications, high protein qualityHigher cost, complex protocolsStructural studies, X-ray crystallography
Pichia pastorisCost-effective, high yieldLacks UDP-Xyl, incomplete glycosylationFunctional studies of glucan synthesis
E. coliRapid, inexpensivePoor for membrane proteins, lacks glycosylationTag-based binding studies

For structural studies requiring high purity and native conformation, mammalian expression systems are recommended despite their higher cost and complexity.

What mutation strategies are most effective for studying CSLC4 function?

T-DNA insertion mutants have proven highly effective for studying CSLC4 function in Arabidopsis. Single mutants (cslc4) as well as higher-order mutants combining mutations in multiple CSLC genes have provided valuable insights into functional redundancy within this gene family . When designing mutation studies:

  • Consider generating both single and higher-order mutants to account for functional redundancy

  • Target multiple independent T-DNA insertion lines for each gene to confirm phenotypes

  • Use qRT-PCR to verify knockout efficiency in your mutant lines

  • Employ complementation analyses with the wild-type gene to confirm that phenotypes are directly caused by the mutation

The quintuple mutant lacking all five CSLC genes (cslc456812) provides a definitive system for studying complete xyloglucan loss, as it lacks detectable xyloglucan while remaining viable .

What analytical techniques are most suitable for detecting and characterizing xyloglucan in CSLC4 studies?

Several complementary techniques are essential for comprehensive xyloglucan characterization:

TechniqueApplicationSensitivitySample Preparation
MALDI-TOF MSStructural analysis, molecular weight determinationHigh (nanomolar)Requires purified oligosaccharides
HPAEC-PADQuantitative analysis of oligosaccharidesHigh (picomolar)Hydrolysis of polysaccharides required
GDP-Glo AssayMeasuring GT activity via GDP release40 nM detection limitRequires purified enzyme and substrate
ImmunolabelingIn situ localization of xyloglucanModerateFixed tissue sections

For enzyme activity assays, researchers have successfully employed the GDP-Glo Glycosyltransferase Assay (Promega) to measure the production of GDP from GDP-Fuc with a detection limit of 40 nM GDP and linear response up to 20 μM . Verification of reaction products should be performed using both mass spectrometry (MALDI-TOF MS) and chromatographic methods (HPAEC-PAD) to ensure robust characterization .

What are the phenotypic consequences of CSLC4 knockout in Arabidopsis?

MutantObserved PhenotypesXyloglucan Content
cslc4 singleMinimal, slight stem bendingSlight decrease
Higher-order mutants with cslc4Smaller rosettes, shorter and bent inflorescence stemsProgressively reduced
cslc45612 and cslc456812Shorter root hairs, reduced pollen tube growthBelow detection limit

The similarity between phenotypes of higher-order cslc mutants (especially the quintuple mutant) and the xxt1 xxt2 double mutant suggests that loss of xyloglucan is the underlying cause of these developmental effects .

How does CSLC4 functional loss compare to mutations in other xyloglucan biosynthesis genes?

Comparative analysis of cslc mutants and other xyloglucan biosynthesis mutants reveals overlapping but distinct phenotypes:

The xxt1 xxt2 double mutant, which lacks xylosyltransferase activity, exhibits aberrant root hairs and no detectable xyloglucan, challenging conventional models of the plant primary cell wall . Similarly, higher-order cslc mutants, particularly those with the cslc12 allele, show shorter root hairs and reduced pollen tube growth . The reduction of xyloglucan in both mutant types leads to significant changes in mechanical properties of these plants.

While fut1-3 mutants (lacking fucosyltransferase activity) produce non-fucosylated xyloglucan polymers, they retain the basic xyloglucan structure, resulting in milder phenotypes than those observed in plants completely lacking xyloglucan . This suggests that the glucan backbone and xylosylation are more critical for cell wall function than fucosylation.

What compensatory mechanisms exist in plants lacking CSLC4 and other CSLC proteins?

Remarkably, even the quintuple cslc mutant (lacking all five CSLC genes) can grow and develop, albeit with altered phenotypes, despite lacking detectable xyloglucan . This unexpected viability raises fundamental questions about cell wall plasticity and adaptation. Analysis shows that the lack of XyG in the cslc quintuple mutant does not trigger significant adaptive responses at the transcriptional level , suggesting that:

  • Other cell wall components may functionally compensate for the loss of xyloglucan

  • The conventional model of xyloglucan as an essential tether between cellulose microfibrils may need revision

  • Plants possess remarkable structural plasticity in primary cell wall architecture

These findings challenge traditional models of primary cell wall structure and function, suggesting greater complexity and redundancy in plant cell wall architecture than previously recognized.

How does CSLC4 interact with xylosyltransferases during xyloglucan synthesis?

Evidence suggests that CSLC4 functionally interacts with xylosyltransferases, particularly XXT1, during xyloglucan synthesis. When coexpressed in Pichia cells, CSLC4 and XXT1 produce longer β-glucan chains compared to expression of CSLC4 alone, despite the absence of xylosylation (as Pichia lacks UDP-Xyl) . This indicates that CSLC4 and XXT1 interact, either directly or indirectly, to modulate β-glucan length.

The molecular basis of this interaction likely involves a membrane complex of xyloglucan glucan synthase (CSLC4) and xylosyltransferases that is more efficient than isolated enzymes at producing the characteristic XXXG repeating structure of xyloglucan found in plants . Though additional research is needed to fully characterize this complex, current evidence strongly suggests that coordinated protein-protein interactions are critical for efficient xyloglucan biosynthesis.

What evidence exists for a multi-enzyme biosynthetic complex involving CSLC4?

Several lines of evidence support the existence of a multi-enzyme complex for xyloglucan biosynthesis:

  • Heterologous expression studies show functional interactions between CSLC4 and XXT1

  • The precise structural regularity of xyloglucan suggests coordinated synthesis

  • The observed XXXG repeating pattern would be difficult to achieve without spatial coordination of enzymes

  • Membrane localization of the biosynthetic machinery in the Golgi apparatus provides a platform for complex formation

The data suggests that a membrane complex of XyG glucan synthase (CSLC4) and xylosyltransferases would be more efficient than solubilized enzymes at producing the observed XXXG repeating structure in plants . Further biochemical and structural studies are needed to characterize the precise architecture and dynamics of this putative complex.

What structural insights have been gained from crystallography studies of xyloglucan glycosyltransferases?

While direct structural data for CSLC4 is not available in the provided search results, significant structural insights have been gained from related glycosyltransferases involved in xyloglucan modification, such as fucosyltransferase 1 (AtFUT1). X-ray crystallography has revealed the structural architecture of AtFUT1 in complex with bound donor and acceptor substrate analogs at high resolution (1.79 Å for AtFUT1-XXLG and 1.90 Å for AtFUT1-GDP) .

These structures have illuminated the mechanistic basis for glycosylation reactions, revealing an atypical water-mediated fucosylation mechanism facilitated by an H-bonded network, which has been corroborated by mutagenesis experiments and detailed atomistic simulations . Similar approaches could be applied to study CSLC4 structure, which would significantly advance our understanding of the xyloglucan glucan synthesis mechanism.

How can molecular dynamics simulations complement experimental studies of CSLC4?

Molecular dynamics simulations can provide valuable insights into CSLC4 function that may be difficult to obtain experimentally:

  • Enzyme mechanism elucidation - As shown with AtFUT1, atomistic simulations can corroborate and extend experimental findings about reaction mechanisms

  • Protein-substrate interactions - Simulations can reveal transient interactions that may not be captured in static crystal structures

  • Conformational dynamics - Understanding how protein dynamics influence catalytic activity

  • Rational mutagenesis design - Identifying key residues for subsequent experimental validation

When designing molecular dynamics studies, researchers should consider:

  • Appropriate force field selection for carbohydrate-protein interactions

  • Sufficient simulation timescales to capture relevant conformational changes

  • Validation with experimental data whenever possible

  • Integration with other computational approaches like quantum mechanics/molecular mechanics (QM/MM) for reaction mechanism studies

What are the most promising approaches for engineering CSLC4 with modified activity or specificity?

Based on insights from glycosyltransferase research, several approaches show promise for engineering CSLC4:

ApproachMethodologyPotential ApplicationsChallenges
Structure-guided mutagenesisTarget catalytic residues based on structural dataAltered product length or rateLimited structural data for CSLC4
Domain swappingExchange domains with related CSLCsModified substrate specificityMay disrupt protein folding
Directed evolutionRandom mutagenesis and screeningNovel activities or improved efficiencyRequires high-throughput screening method
Chimeric enzyme creationFusion of CSLC4 with other GTsOne-pot synthesis of complex oligosaccharidesPotential interface incompatibility

When implementing these approaches, researchers should consider:

  • Establishing robust activity assays specific to CSLC4

  • Developing heterologous expression systems that yield active enzyme

  • Creating appropriate screening methods to identify desired modifications

  • Validating engineered variants in planta through complementation of cslc mutants

What are the main technical barriers to studying CSLC4 biochemistry and how can they be overcome?

Several technical challenges have limited CSLC4 research:

  • Membrane protein expression and purification - As a type II membrane protein, CSLC4 is challenging to express and purify in active form. Mammalian cell expression systems have shown promise for related glycosyltransferases , and detergent screening is critical for maintaining activity during purification.

  • In vitro activity assays - Demonstrating activity of purified CSLC4 requires appropriate donor (UDP-glucose) and potentially acceptor molecules. Researchers should consider luminescence-based assays like the GDP-Glo system, which has shown high sensitivity (40 nM detection limit) for related glycosyltransferases .

  • Product analysis - Multiple analytical techniques should be employed in parallel, including MALDI-TOF MS and HPAEC-PAD, to verify reaction products as demonstrated for other xyloglucan-modifying enzymes .

  • Functional redundancy - The overlapping functions of multiple CSLC proteins necessitates careful genetic approaches using higher-order mutants to fully reveal CSLC4 function .

How can the apparent contradiction between xyloglucan's presumed importance and the viability of xyloglucan-deficient mutants be resolved?

The discovery that plants lacking detectable xyloglucan (both xxt1 xxt2 and cslc quintuple mutants) remain viable despite showing some developmental defects presents a fundamental challenge to conventional cell wall models . Several hypotheses may explain this apparent contradiction:

  • Functional redundancy - Other cell wall polysaccharides may partially compensate for xyloglucan's absence

  • Context-dependent importance - Xyloglucan may be critical under specific stress conditions not tested in laboratory settings

  • Structural model revision - The tethered network model of primary cell walls may need significant revision

  • Threshold requirements - Residual xyloglucan below detection limits may be sufficient for minimal function

Resolving this contradiction requires:

  • More sensitive analytical techniques to detect potential trace amounts of xyloglucan

  • Comprehensive mechanical testing of cell walls in mutant plants

  • Studies under diverse environmental conditions to reveal conditional phenotypes

  • Advanced imaging to directly visualize cell wall architecture in mutants

What is the evolutionary significance of CSLC4 conservation across plant species?

The conservation of CSLC4 orthologs across plant species despite the viability of xyloglucan-deficient mutants raises evolutionary questions. While the search results don't directly address this, several hypotheses can be proposed:

  • Xyloglucan may provide selective advantages under natural conditions not apparent in laboratory settings

  • CSLC4 may have additional functions beyond xyloglucan synthesis that remain to be discovered

  • The developmental defects observed in mutants, while not lethal under controlled conditions, may significantly impact fitness in natural environments

  • Regulatory or structural functions of CSLC4 independent of its catalytic activity may be evolutionarily important

Future comparative genomic studies combined with phylogenetic analyses could help clarify when CSLC4 function emerged during plant evolution and how it correlates with changes in cell wall architecture.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.