Recombinant Arabidopsis thaliana Ycf20-like protein (At1g65420)

Shipped with Ice Packs
In Stock

Description

Functional Role in Photoprotection

At1g65420 (NPQ7) operates in chloroplasts to regulate thermal energy dissipation under excess light stress:

  • NPQ Mechanism: Works redundantly with NPQ6 (At5g43050) to dissipate chlorophyll excitation energy as heat, preventing oxidative damage .

  • Mutant Phenotypes:

    • Single mutants (npq6 or npq7) show 30–40% reduced NPQ capacity .

    • Double mutants (npq6 npq7) exhibit additive defects, confirming overlapping roles .

  • Evolutionary Conservation: Belongs to the YCF20 family, conserved across cyanobacteria and plants .

Biochemical Studies

  • Protein-Protein Interactions: Used to identify binding partners in chloroplast membranes, including components of the photosynthetic electron transport chain .

  • Structural Analysis: Serves as a template for resolving membrane protein architectures via cryo-EM or X-ray crystallography .

Stress Response Modeling

  • Photoprotection Assays: Recombinant protein aids in in vitro reconstitution of NPQ pathways to study abiotic stress adaptations .

  • Gene Editing: CRISPR/Cas9-modified variants help dissect residue-specific contributions to NPQ efficiency .

Production and Purification Protocol

Recombinant At1g65420 is generated using:

  1. Cloning: Full-length cDNA inserted into pET-based vectors .

  2. Expression: Induced with IPTG in E. coli BL21(DE3) at 18°C .

  3. Purification: Affinity chromatography (Ni-NTA) followed by size-exclusion chromatography .

  4. Quality Control: Validated by Western blot (anti-His antibodies) and circular dichroism for folding .

Challenges and Future Directions

  • Solubility Issues: Membrane localization necessitates detergent-based extraction, complicating structural studies .

  • Functional Redundancy: Overlapping roles with NPQ6 demand dual-knockout models for phenotypic analysis .

  • Biotechnological Potential: Engineered variants could enhance crop stress tolerance through improved NPQ regulation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
At1g65420; T8F5.20; Ycf20-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-197
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At1g65420
Target Protein Sequence
MACQIQASRVFPVLEIEKGLSFMINVFHRRIKASSITLTSFPYPMKSFQIRRPNRKIAFA LDTGSSIPGDSGEGQEMNGDRTGLGSTRLGRIAIAGGKQLLGKINSARKNFPMKIFLLLL GFYTANALATILGQTGDWDVLVAGIVVAAIEGIGMLMYKKPSSSMFSGKLQSFVVFMNFW KAGVCLGLFVDAFKLGS
Uniprot No.

Target Background

Gene References Into Functions
  1. A mutant with a T-DNA insertion in the At1g65420 gene exhibited a low non-photochemical quenching (NPQ) of chlorophyll fluorescence phenotype. At1g65420 was designated NPQ7. PMID: 20087601
Database Links

KEGG: ath:AT1G65420

STRING: 3702.AT1G65420.1

UniGene: At.28694

Protein Families
Ycf20 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How was NPQ7 (At1g65420) first identified and characterized in relation to photosynthetic function?

NPQ7 was identified through reverse genetics approaches. Researchers identified a mutant with a T-DNA insertion within the At1g65420 gene and observed that it exhibited a low NPQ phenotype similar to that of the previously characterized npq6 mutant . This phenotypic similarity led to the gene being named NPQ7.

The characterization involved:

  • Identification of the gene through positional cloning

  • Confirmation of the mutation's effect through complementation studies

  • Measurement of nonphotochemical quenching (NPQ) levels in mutant plants

  • Comparison with other similar mutations (particularly npq6)

The study revealed that the npq6 npq7 double mutant had an additive NPQ defect, indicating that YCF20 family members in Arabidopsis have overlapping functions affecting thermal dissipation .

What are the recommended methods for expression and purification of recombinant At1g65420 protein?

Based on available research protocols, the recommended methods for expression and purification of recombinant At1g65420 include:

Expression System:

  • E. coli is the preferred expression system for this protein

  • The full-length protein (1-197 amino acids) should be fused to an N-terminal His tag

Purification Protocol:

  • Express the protein in E. coli with appropriate induction parameters

  • Harvest and lyse cells under native conditions

  • Purify using affinity chromatography with Ni-NTA or similar matrices

  • Elute with an imidazole gradient

  • Perform additional purification steps if needed (ion exchange, size exclusion)

  • Dialyze against storage buffer

  • Lyophilize the purified protein or store in liquid form with glycerol

Storage Recommendations:

  • Store lyophilized powder at -20°C/-80°C

  • For working aliquots, store at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles

  • For long-term storage, add 5-50% glycerol (50% recommended) and store at -20°C/-80°C

How can researchers effectively measure nonphotochemical quenching (NPQ) in At1g65420 mutant studies?

To effectively measure NPQ in At1g65420 (NPQ7) mutant studies, researchers should:

Sample Preparation:

  • Grow Arabidopsis plants (wild-type and mutant) under controlled conditions

  • Use plants of similar developmental stages (typically 3-4 weeks old)

  • Dark-adapt leaves for at least 20-30 minutes prior to measurements

Measurement Protocol:

  • Use a pulse-amplitude modulated (PAM) fluorometer to measure chlorophyll fluorescence

  • Record the maximum fluorescence in the dark-adapted state (Fm)

  • Apply actinic light to induce NPQ

  • Measure maximum fluorescence in the light-adapted state (Fm')

  • Calculate NPQ using the formula: NPQ = (Fm - Fm')/Fm'

  • Monitor NPQ induction and relaxation kinetics

Controls and Comparisons:

  • Include wild-type plants as positive controls

  • Include known NPQ mutants (e.g., npq6) for comparison

  • When testing At1g65420 function, consider generating and testing double mutants (e.g., npq6 npq7) to assess additive effects

Data Analysis:

  • Compare NPQ values between genotypes at various light intensities

  • Analyze the kinetics of NPQ induction and relaxation

  • Separate the components of NPQ (qE, qT, qI) based on relaxation kinetics

What is the relationship between At1g65420 (NPQ7) and other YCF20 family members in plant thermal dissipation mechanisms?

The YCF20 protein family is conserved across oxygenic photosynthetic organisms, including cyanobacteria, eukaryotic algae, and plants . In Arabidopsis, there are three YCF20 family members: At5g43050 (NPQ6), At1g65420 (NPQ7), and At3g56830.

Functional Relationships:

  • NPQ6 and NPQ7 have similar but not identical functions in thermal dissipation

  • Both npq6 and npq7 mutants show partial defects in NPQ induction

  • The npq6 npq7 double mutant displays an additive NPQ defect, suggesting overlapping functions

  • The third family member (At3g56830) appears to have a minimal role in NPQ, as knockdown mutants show wild-type NPQ levels

Evolutionary Conservation:

  • YCF20 proteins are found throughout photosynthetic organisms

  • Their conservation suggests fundamental roles in photosynthetic function

  • Despite this conservation, specific functions may have diverged between different organisms

Molecular Interactions:

  • YCF20 proteins may form complexes with other photosynthetic proteins

  • They may interact with components of the photosynthetic electron transport chain

  • Research should focus on identifying protein-protein interactions to better understand their mechanism of action

What are the current methodological challenges in studying the interaction of At1g65420 with the photosynthetic apparatus?

Studying the interaction of At1g65420 (NPQ7) with the photosynthetic apparatus presents several methodological challenges:

Protein Localization Challenges:

  • The precise sub-chloroplast localization needs to be determined with high resolution

  • Recommended approach: Use fluorescently tagged versions of At1g65420 combined with confocal microscopy

  • Challenge: Ensuring the tag doesn't interfere with protein function or localization

Protein-Protein Interaction Studies:

  • Identifying direct interaction partners is crucial but technically challenging

  • Recommended approaches:

    • Yeast two-hybrid screening (as used to show interaction between AtPRD1 and AtSPO11-1)

    • Co-immunoprecipitation followed by mass spectrometry

    • FRET/FLIM analyses for in vivo interaction studies

  • Challenge: Membrane-associated proteins are often difficult to study with these techniques

Structural Analysis:

  • Obtaining crystal structures of At1g65420 alone and in complex with partners

  • Recommended approaches:

    • Recombinant expression and purification of stable protein

    • Crystallization trials under various conditions

    • Cryo-EM as an alternative approach

  • Challenge: YCF20 family proteins may be difficult to crystallize

Functional Reconstitution:

  • In vitro reconstitution of NPQ mechanisms with purified components

  • Challenge: Maintaining protein stability and activity outside their native environment

How do researchers reconcile conflicting data on the role of YCF20 family proteins in different photosynthetic organisms?

Researchers face several data conflicts when studying YCF20 family proteins across different organisms:

Inconsistencies Between Species:

  • While YCF20 proteins are conserved across photosynthetic organisms, their specific functions may vary

  • Some studies suggest primary roles in photosynthesis, while others indicate roles in stress responses

  • Reconciliation approach: Perform comparative functional studies across multiple model organisms

Phenotypic Variations:

  • Knockout mutants show varying severity of phenotypes in different species

  • Some organisms show compensatory mechanisms that mask phenotypes

  • Reconciliation approach: Use graded expression systems (e.g., inducible RNAi) to study dose-dependent effects

Methodological Recommendations:

  • Standardize experimental conditions across studies

  • Use multiple complementary techniques to verify findings

  • Develop more sensitive assays to detect subtle phenotypic differences

  • Perform comprehensive phylogenetic analyses to understand evolutionary relationships

What experimental approaches should be used to determine if At1g65420 directly interacts with photosystem components or acts through indirect mechanisms?

To determine whether At1g65420 (NPQ7) directly interacts with photosystem components or functions through indirect mechanisms, researchers should employ a multi-faceted approach:

Direct Interaction Studies:

  • In vitro binding assays: Use purified recombinant At1g65420 and photosystem components

  • Surface plasmon resonance (SPR): Measure binding kinetics and affinities

  • Crosslinking studies: Capture transient interactions followed by mass spectrometry

Functional Proximity Analysis:

  • FRET/FLIM: Express fluorescently tagged versions of At1g65420 and candidate interaction partners

  • Split GFP complementation: Test for proximity in vivo

  • Bimolecular fluorescence complementation (BiFC): Visualize interactions in plant cells

Structural Studies:

  • Single-particle cryo-EM: Analyze potential complexes

  • Protein footprinting: Identify interaction interfaces

  • Hydrogen-deuterium exchange mass spectrometry: Map binding regions

Genetic Approaches:

  • Suppressor screens: Identify mutations that restore NPQ in npq7 mutants

  • Synthetic lethality screens: Identify genes that become essential in an npq7 background

  • Domain swap experiments: Replace domains to identify functional regions

The combined evidence from these approaches would provide a comprehensive understanding of whether At1g65420 functions through direct physical interactions with photosystem components or through indirect signaling mechanisms.

What are the key considerations when comparing different recombinant At1g65420 protein preparations for research applications?

When comparing different recombinant At1g65420 protein preparations, researchers should consider:

ParameterCommercial Full-Length Protein Partial Protein Research Considerations
LengthFull-length (1-197aa)PartialFull-length preferred for functional studies
Expression SystemE. coliE. coli/Yeast/Baculovirus/MammalianE. coli simplest, but may lack post-translational modifications
TagN-terminal HisVarious optionsTag position may affect activity
Purity>90%>90%Verify by SDS-PAGE
FormLyophilized powderLiquid with glycerolForm affects stability and handling
Storage-20°C/-80°C-20°C/-80°CAvoid repeated freeze-thaw
BufferTris/PBS-based, pH 8.0VariableBuffer affects stability and activity

Researchers should select preparations based on their specific experimental needs, considering:

  • Functional assays may require full-length protein with minimal tags

  • Structural studies may benefit from constructs optimized for stability

  • Interaction studies might require specific tags for pull-down experiments

  • Activity assays may be sensitive to buffer conditions

How can researchers validate that a recombinant At1g65420 protein retains its native function?

To validate that recombinant At1g65420 retains native function, researchers should employ the following comprehensive approach:

Biochemical Validation:

  • Circular dichroism (CD) spectroscopy to verify proper protein folding

  • Size exclusion chromatography to confirm oligomeric state

  • Limited proteolysis to test for structural integrity

Functional Complementation:

  • Express the recombinant protein in npq7 mutant plants

  • Measure restoration of NPQ phenotype

  • Quantify complementation efficiency compared to wild-type

Activity Assays:

  • Develop in vitro assays that measure aspects of NPQ

  • Compare activity of recombinant protein to native protein extracted from plants

  • Test activity under various conditions (light intensity, pH, temperature)

Interaction Validation:

  • Verify that recombinant protein maintains known protein-protein interactions

  • Use pull-down assays with known partners

  • Compare interaction profile with native protein

A truly functional recombinant At1g65420 should show similar structural properties to the native protein and be able to complement the npq7 mutant phenotype when properly expressed in plants.

What emerging technologies might advance our understanding of At1g65420's role in plant stress responses?

Several emerging technologies show promise for advancing our understanding of At1g65420's role in plant stress responses:

Advanced Imaging Technologies:

  • Super-resolution microscopy to visualize protein localization and dynamics at nanometer scale

  • Light sheet microscopy for whole-plant imaging with minimal phototoxicity

  • Label-free imaging methods to observe proteins in their native state

Single-Cell Approaches:

  • Single-cell RNA-seq to identify cell-type specific expression patterns

  • Single-cell proteomics to measure protein abundance in different cell types

  • Spatial transcriptomics to map expression in intact tissues

CRISPR-Based Technologies:

  • Base editing for precise mutagenesis without double-strand breaks

  • CRISPRi/CRISPRa for tunable gene expression modulation

  • CRISPR screening to identify genetic interactions

Integrative Omics:

  • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

  • Systems biology modeling of stress response networks

  • Comparative genomics across species with varying stress tolerance

In Situ Structural Biology:

  • Cryo-electron tomography to visualize protein complexes in their cellular context

  • In-cell NMR to study protein structure and dynamics in living cells

  • In situ cross-linking mass spectrometry to capture transient interactions

These emerging technologies will help provide a more comprehensive understanding of At1g65420's dynamic role in plant stress responses and thermal dissipation mechanisms.

How might research on At1g65420 contribute to engineering improved photosynthetic efficiency in crops?

Research on At1g65420 (NPQ7) has significant potential to contribute to engineering improved photosynthetic efficiency in crops:

Optimization of NPQ Dynamics:

  • Fine-tuning NPQ induction and relaxation kinetics could improve light use efficiency

  • Modulating At1g65420 expression levels or activity could create crops that better balance photoprotection and photosynthesis

  • Engineering variants with altered regulatory properties could optimize performance under fluctuating light conditions

Cross-Species Applications:

  • Transferring optimized versions of At1g65420 to crop species

  • Engineering chimeric proteins combining beneficial features from different species

  • Using comparative studies to identify superior natural variants

Practical Implementation Strategies:

  • Targeted breeding programs focusing on NPQ efficiency

  • Transgenic approaches for direct gene modification

  • CRISPR-based precision engineering of endogenous genes

Potential Agricultural Benefits:

  • Improved crop yields under high light stress conditions

  • Enhanced resilience to fluctuating light environments

  • Better performance under combined stress conditions (light, temperature, drought)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.